KEGG   Bacillus subtilis subsp. subtilis 168: BSU20900Help
Entry
BSU20900          CDS       T00010                                 

Gene name
yopG
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939181
NCBI-ProteinID: NP_389972
Pasteur: BG13640
BSORF: BG13640
UniProt: O31931
Position
complement(2211884..2212015)
Genome map
AA seq 43 aa AA seqDB search
MYWIEWIENGEKKNIVAEGWIEWAAILEDLYQKRFEYVEWKRL
NT seq 132 nt NT seq  +upstreamnt  +downstreamnt
gtgtattggatagagtggattgagaatggagaaaagaaaaacattgttgcagaaggttgg
attgaatgggctgctatacttgaagacttgtatcagaagcggttcgagtatgttgaatgg
aagcggctataa

DBGET integrated database retrieval system