KEGG   Bacillus subtilis subsp. subtilis 168: BSU20910Help
Entry
BSU20910          CDS       T00010                                 

Gene name
yopF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EF-hand_6
Motif
Other DBs
NCBI-GeneID: 939179
NCBI-ProteinID: NP_389973
Pasteur: BG13639
BSORF: BG13639
UniProt: O31932
Position
complement(2212026..2212241)
Genome map
AA seq 71 aa AA seqDB search
MPLIDYFYVLQFENKEYFKAFKLDESGYLTSSDLHEASKIHNMLEVIEVASELKTKCNVQ
CEVREIQVVKR
NT seq 216 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgattgattatttttatgtactgcagtttgaaaacaaggaatactttaaagca
tttaaattagatgagagtggttatttgacatctagcgacctccatgaagcttctaaaata
cataatatgttagaagtcatcgaggtagcaagtgagcttaaaacgaagtgtaatgtgcaa
tgtgaggtaagggaaattcaagtcgtaaagcgttag

DBGET integrated database retrieval system