KEGG   Bacillus subtilis subsp. subtilis 168: BSU20920Help
Entry
BSU20920          CDS       T00010                                 

Gene name
yopE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OppC_N
Motif
Other DBs
NCBI-GeneID: 939183
NCBI-ProteinID: NP_389974
Pasteur: BG13638
BSORF: BG13638
UniProt: O31933
Position
complement(2212245..2212496)
Genome map
AA seq 83 aa AA seqDB search
MIGLAYFLIIWLGVGLLTGIKFIFVDQVYDEEFKELMDKETAAGMERNLASLFFKNKLNV
IAFFMLIGLLPLAMRITKLFKRG
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgattggattagcttattttttaattatttggcttggagttggattattgactggcatt
aagtttatttttgttgatcaggtctatgatgaagagtttaaagaactcatggataaagaa
acagcagcgggcatggaaaggaatttggccagcctgtttttcaaaaataagcttaatgtg
attgctttttttatgttaattggtttactgccattggcaatgaggattacaaaattattt
aaaagaggttga

DBGET integrated database retrieval system