KEGG   Bacillus subtilis subsp. subtilis 168: BSU20920
Entry
BSU20920          CDS       T00010                                 

Gene name
yopE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939183
NCBI-ProteinID: NP_389974
Pasteur: BG13638
BSORF: BG13638
UniProt: O31933 A0A6M3ZCU8
Position
complement(2212245..2212496)
AA seq 83 aa
MIGLAYFLIIWLGVGLLTGIKFIFVDQVYDEEFKELMDKETAAGMERNLASLFFKNKLNV
IAFFMLIGLLPLAMRITKLFKRG
NT seq 252 nt   +upstreamnt  +downstreamnt
atgattggattagcttattttttaattatttggcttggagttggattattgactggcatt
aagtttatttttgttgatcaggtctatgatgaagagtttaaagaactcatggataaagaa
acagcagcgggcatggaaaggaatttggccagcctgtttttcaaaaataagcttaatgtg
attgctttttttatgttaattggtttactgccattggcaatgaggattacaaaattattt
aaaagaggttga

DBGET integrated database retrieval system