KEGG   Bacillus subtilis subsp. subtilis 168: BSU20928Help
Entry
BSU20928          CDS       T00010                                 

Gene name
yoyH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TBCC
Motif
Other DBs
NCBI-GeneID: 8303201
NCBI-ProteinID: YP_003097748
UniProt: C0H437
Position
2212567..2212746
Genome map
AA seq 59 aa AA seqDB search
MEEKYETNGYDTSIVYDYKEYPDVKYGRCDNCDYTLFKSSVKSGIFLRECRRCGMKKSI
NT seq 180 nt NT seq  +upstreamnt  +downstreamnt
gtggaagagaaatacgaaacaaacggatatgacacttcaatcgtatatgattacaaagaa
tatcctgatgtaaaatacggccgctgcgacaattgtgattacactttgtttaaaagctct
gtgaagagtggaatatttttacgtgaatgcagaaggtgtggcatgaaaaagagcatttag

DBGET integrated database retrieval system