KEGG   Bacillus subtilis subsp. subtilis 168: BSU20929Help
Entry
BSU20929          CDS       T00010                                 

Gene name
yoyI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 7TMR-DISM_7TM DUF3953
Motif
Other DBs
NCBI-GeneID: 8302920
NCBI-ProteinID: YP_003097749
UniProt: C0H438
Position
2212848..2213078
Genome map
AA seq 76 aa AA seqDB search
MLKVAKISVSCIVLVLCIYSLFNQNELLLIVVQLFVAALLSLVGVEAILSKQKLSEYLLF
GSAAFLLVVNGVKFII
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaagttgcaaaaatttcggtttcttgcattgtattagtcttgtgcatatactca
ttgttcaatcaaaatgaattattgttgattgttgtgcaattatttgttgccgccctttta
tcattagtcggagttgaagcgatattaagcaaacaaaaactgtccgaatatttactgttt
ggatcagcagccttcttacttgttgtaaacggtgtgaaattcataatttaa

DBGET integrated database retrieval system