KEGG   Bacillus subtilis subsp. subtilis 168: BSU20930Help
Entry
BSU20930          CDS       T00010                                 

Gene name
yopD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0715 DUF3394
Motif
Other DBs
NCBI-GeneID: 939180
NCBI-ProteinID: NP_389976
Pasteur: BG13637
BSORF: BG13637
UniProt: O31934
Position
complement(2213083..2213478)
Genome map
AA seq 131 aa AA seqDB search
MSLNQKALNSYVYTLAFSSLSFGLIFGLYLFVYSGFMAIALVTIAIIAFYALITYLVFAA
PLQVWLRRRRRKFSLINFLIYIAVAFSAVFLFWFVDYPPNALTMFRSFEYYIMSIVAAFI
YWFWDSIFLRN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
ttgagcctcaatcaaaaagcgttaaacagttatgtttatactctggcgttttcaagtttg
tcatttggtctaatttttggtctgtatctgtttgtttactctggatttatggcaatagca
ttagtcacaattgccatcattgcattttacgctttaatcacttacttggtgtttgctgcc
cctttgcaagtgtggctaagaagaaggcgcagaaaattcagtttgatcaattttttaatt
tatattgcagtggccttttcagctgtgtttttgttctggtttgttgattatccgccaaat
gctcttaccatgttcagaagctttgagtattacattatgagtattgtagctgcgtttatt
tattggttttgggattcgatattcctacgaaattaa

DBGET integrated database retrieval system