KEGG   Bacillus subtilis subsp. subtilis 168: BSU20940
Entry
BSU20940          CDS       T00010                                 

Gene name
yopC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: RES
Other DBs
NCBI-GeneID: 939177
NCBI-ProteinID: NP_389977
Pasteur: BG13636
BSORF: BG13636
UniProt: O31935 A0A6M3ZCK5
Position
complement(2213536..2214864)
AA seq 442 aa
MDLYRKAKRLKKELSKHEEINDSLKELAFDIFKELTVKPEFIDKNTNDVIGEEKINTSTF
SNKERLDILIEWTIEIDPILSFIIDKCDIPIERTGGDDLDAFMENVYTEYIEELHKLPNR
KSFDSSKITKIESFAQQITKTIELYLDGYVHLAYAEFDKGMNIFSEEVNIEELLLYNIDS
IRIPCKFFRMRTSNTEVFSKDDMFHIPFEKRGIIRTNRFSIPGFPCLYLGSSSLVCWEEL
GRPDLNTTYTSVFHLEDEDIKILDLSVSPTELADNLKKFFEITFRRKIYKFNAYFMTWIL
ISACLIRVKKQKDIFKPEYIIPQFLLEWVKQTESSEYWGICYLSSKINRQTIENYKLYKN
YAIPVRQRKDSGHCSLLGETFQISDPVAWETFQSHKDSPESLPIKNPLFPETEGTHHDYH
KTELGRLEAFLIRYRSVVKDQL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atggatttgtatagaaaagctaaaaggctaaaaaaagaattatcgaaacatgaggaaatt
aatgattctttgaaagagcttgcatttgatatttttaaagagttaacagtaaaacctgaa
tttatagacaaaaacaccaatgatgttattggggaggaaaaaattaacaccagcaccttt
tcaaataaagaaaggttagacattttaattgaatggactattgaaatagatccaatatta
agttttattattgataaatgcgatattccaatagaaagaacgggtggggatgatttagat
gcttttatggagaatgtttatacagaatatatagaagaattgcataagctaccaaataga
aaatcattcgattcatcaaaaatcacaaagatagaatcttttgcgcaacaaattactaaa
acaattgaactttacttagatggttatgtgcatttagcatatgctgaatttgataaagga
atgaatatcttttctgaagaggttaacattgaagagctgctcttatataacattgatagt
attcgtattccttgtaaattctttagaatgagaaccagtaacacagaggttttttctaaa
gatgatatgtttcatataccatttgagaagagaggaataatacgcacaaatcgttttagt
ataccaggatttccatgtctttaccttggaagttcatcacttgtttgttgggaagaacta
ggaaggcctgacttaaatactacctacacttcggtttttcaccttgaggatgaagatata
aaaattctggatttaagtgtttcacctacggaactggcagataatctaaagaaatttttt
gaaataacatttagaagaaaaatatataaatttaatgcatactttatgacatggatttta
atatctgcatgcctaattagagtaaaaaaacaaaaagacatttttaaaccagaatatatc
attcctcaatttttgcttgaatgggttaaacagacagagtcttcggaatactggggaatc
tgttatttgtcttctaagattaacagacaaacaattgaaaattacaagctatataagaat
tatgctattcctgttaggcaaagaaaagacagtggacattgttcgttattgggcgagaca
ttccaaatatctgaccccgtagcttgggaaacgttccaaagtcataaggactcaccagaa
tcgcttcctatcaaaaatccattatttccagaaaccgaagggactcatcatgattaccat
aaaacagagttggggagactagaggcctttttaattagatatagatcagttgttaaagac
caactgtaa

DBGET integrated database retrieval system