KEGG   Bacillus subtilis subsp. subtilis 168: BSU20950
Entry
BSU20950          CDS       T00010                                 

Gene name
yopB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: HTH_26 HTH_19
Other DBs
NCBI-GeneID: 939178
NCBI-ProteinID: NP_389978
Pasteur: BG13635
BSORF: BG13635
UniProt: O31936 A0A6M4JNG4
Position
complement(2214972..2215199)
AA seq 75 aa
MIRSNLKSIIDERKISIRKLSRDIDHEYPTVRKLYNDEMERYPRDLLDKVCTYLNIELQE
LLIFEKSHNHIDHSG
NT seq 228 nt   +upstreamnt  +downstreamnt
atgattagatcaaatttaaagtccataatagacgaaagaaagatcagtatccggaagcta
tctagagatattgatcatgagtatccaactgtcagaaagctttataatgacgaaatggag
cggtatccaagagatctgttagataaagtctgtacatacctaaacatcgagctgcaggaa
ttgctgatattcgaaaaaagccataaccatatcgatcactcaggatga

DBGET integrated database retrieval system