KEGG   Bacillus subtilis subsp. subtilis 168: BSU20960Help
Entry
BSU20960          CDS       T00010                                 

Gene name
yopA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEPN_Apea
Motif
Other DBs
NCBI-GeneID: 939175
NCBI-ProteinID: NP_389979
Pasteur: BG13634
BSORF: BG13634
UniProt: O31937
Position
complement(2215460..2216776)
Genome map
AA seq 438 aa AA seqDB search
MENIALESSFLEYDINEPIKIYTGHFTIEVADDFFEILGEVKIAFLPKARLIFEGAISGN
LSKLFEFEKAMKSNNMMINVPGFMKSEVLISGITDGSKGNKVSGILKRSILTSAETKVNR
MEFTVVNFVNDLGRRIVHGRFKFSGRTKLKYKDWEIILDKRYDYSNKKIFDRLKNSGGYL
ITHVGYLKRVDDKLFDTKEVEPLISGLYWLLSFSAGRHVAIPTLEGYHNEEVIWSKYQVP
LIDGWTNNITWFPKQKSPSLEHLFPKVIEKQEDPFWNKVLWEVLSWYSQAHSSSIVENKV
VSVQVALETLAWVYLIVDRKSNISKSKYKYMNAAEKFREILSRFSIDLSIPKLFIDIKDN
YDDGPHLFTVFRNKIVHPTRELDFDNPIDKLHVLYLGVWYLELLTLGILGYEGSYVNRLK
VPIIEGVYEFVPWKTRDN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaatatagctcttgaatcctcctttttagagtacgatattaatgaaccgattaaa
atctataccggccactttacaattgaagttgctgatgatttttttgaaatcttgggagaa
gttaaaattgcatttttaccaaaagctagactaatatttgaaggagccatttcaggcaat
cttagcaagcttttcgaatttgaaaaggcaatgaaaagtaataatatgatgattaatgta
cctggatttatgaaatctgaagttcttatttcaggtataacagacggaagtaaagggaac
aaagtatcagggatactaaaacgatctattttaacctcagctgaaactaaagtgaataga
atggaattcacggtggttaacttcgtgaatgatttaggtagaaggattgtgcatggaagg
tttaaattttcagggagaacaaaattaaaatataaagattgggaaataattttggataag
cgatatgactattcaaacaaaaaaatctttgatagattaaaaaattcgggtggatactta
ataacacatgtgggatatttaaaaagagtggatgataaattatttgatactaaagaagta
gaaccacttatttcagggctttattggttattatccttttcagcaggtagacatgttgct
atccctacattggaaggataccacaacgaggaggtaatatggagtaaataccaagttcca
ttaatagatggctggactaataatattacttggtttccaaaacaaaaatctccatcctta
gaacatttatttccaaaggtgattgagaagcaagaagatcctttttggaataaagtttta
tgggaagtgttgagttggtactcccaagcacattcatcaagtatagtagaaaacaaggtg
gtatctgttcaggttgcattggaaactttggcgtgggtgtatcttattgtagacagaaaa
tccaatattagtaaatcgaaatataagtatatgaatgcagcagagaaatttagagaaata
ttatctagattttcaattgacttatcaataccaaaactctttattgacattaaggataat
tatgacgatggcccacacctttttactgtatttaggaataagatagtccatcctacaagg
gaacttgattttgacaatccgatagataagctccatgtactttatcttggtgtttggtat
cttgaattactaacacttggaatattgggatatgaaggaagttatgtaaaccgtttaaag
gtacctataatagaaggagtatatgaatttgtcccttggaaaacaagagacaattaa

DBGET integrated database retrieval system