KEGG   Bacillus subtilis subsp. subtilis 168: BSU20980Help
Entry
BSU20980          CDS       T00010                                 

Gene name
yonV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ResIII AAA_14 Viral_helicase1
Motif
Other DBs
NCBI-GeneID: 939174
NCBI-ProteinID: NP_389981
Pasteur: BG13632
BSORF: BG13632
UniProt: O31939
Position
complement(2217967..2219199)
Genome map
AA seq 410 aa AA seqDB search
MERVKVIDSIMGSGKTTYIIKMMNEAPKNEHFIFITPYLDEVTRIKRSCTNRKFYEPKIH
SEEGETLYKLDSLHKHLADNNDIVTTHALFSMANETTKELIYSGNYTLILDETMEVVKKL
NISKDDLDMLFQNEWIKNNNGTIIWNDEQERNLNREYKGEFQTLKHLAKSKNLILHNESV
LFWQFPADIFAQFKQVYNLTYLFDAQIQKYYYDINGIEYELYAVVKDNDSYKLMQHSRQF
DKAKKDVLRHKIKIYEGDLNKIGDDYYALSKNWFEKRSVLHKRLKNNILNYYQNILKSKS
KGNLWTTFKSHKSKLSGKGYTKGFLACNIKATNEYSHKRSLVYSINRFVNPAIDDYFRSK
GIIINEDNFALSEMIQWIWRSAIRNGQDINIYVPSSRMRKLLMDWLENQR
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagttaaagttatcgattctattatgggatctggtaaaacaacttacattatt
aagatgatgaatgaggcaccaaagaatgagcattttatctttatcacaccatatcttgat
gaggtaacaagaataaagaggtcatgtacgaatagaaagttttacgaaccaaaaatacat
agtgaggaaggggaaacgctctataaactggattcattacataaacatttagcagataac
aatgacattgtaacaactcatgctttattcagtatggctaatgaaacaactaaagaattg
atttactcaggcaattatactcttatcctggatgaaactatggaagtggttaagaaatta
aatatatccaaggatgatctggatatgctgttccaaaatgaatggattaagaacaataat
ggcacaatcatttggaatgatgaacaagaaagaaatcttaatagggaatataaaggagag
ttccaaacacttaaacatttggccaagagtaaaaacttaattttgcataatgagtctgta
ttgttttggcagtttcctgcagacatctttgcccaatttaaacaggtctataatcttaca
tatttgtttgatgctcagattcagaaatattattatgacattaacggaatagaatatgaa
ctttatgcagtagtcaaagacaatgacagttataaattaatgcagcacagtaggcaattt
gataaagcaaagaaggatgtcctaagacataaaattaaaatatatgaaggtgacttgaat
aaaattggtgatgattattatgcattatcaaaaaactggtttgaaaaacgttcagtgtta
cataaacggcttaagaataatattctgaattactaccagaatatacttaaatcaaagtct
aagggtaatctttggacaacttttaaatcacataaaagtaaactaagtgggaaaggttat
acgaaaggctttttagcctgtaacatcaaagcaacgaacgaatacagtcacaaaagatct
ttggtttattcaataaacagattcgttaatcctgcaattgatgattattttagatccaag
ggaataatcataaacgaggacaattttgctttatctgagatgattcaatggatttggaga
tcagctataagaaatggacaggatattaatatatatgtcccatcatcacgaatgagaaag
ctgttaatggattggttagagaaccagagataa

DBGET integrated database retrieval system