KEGG   Bacillus subtilis subsp. subtilis 168: BSU20990Help
Entry
BSU20990          CDS       T00010                                 

Gene name
yonU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APG6_N DUF1664 CENP-F_leu_zip GrpE COG6 JIP_LZII Med4 YabA
Motif
Other DBs
NCBI-GeneID: 939176
NCBI-ProteinID: NP_389982
Pasteur: BG13631
BSORF: BG13631
UniProt: O31940
Position
complement(2219281..2219469)
Genome map
AA seq 62 aa AA seqDB search
MEKKFLDAIQQLTKELEMLKKDIDSIKEATVRIDKDLLEYREEISKVKQDDSVLIMQQHK
DN
NT seq 189 nt NT seq  +upstreamnt  +downstreamnt
ttggagaaaaaattcctggatgctattcagcagctaacaaaggaattggaaatgctcaag
aaagatattgactccatcaaagaagcaactgtcagaattgataaagaccttttagagtac
agagaagagataagcaaagtaaaacaagatgattcagtattaatcatgcagcaacacaag
gataattaa

DBGET integrated database retrieval system