KEGG   Bacillus subtilis subsp. subtilis 168: BSU20999Help
Entry
BSU20999          CDS       T00010                                 

Gene name
yoyJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VEGFR-2_TMD Orf78
Motif
Other DBs
NCBI-GeneID: 8303210
NCBI-ProteinID: YP_003097750
UniProt: C0H439
Position
complement(2219514..2219765)
Genome map
AA seq 83 aa AA seqDB search
MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEGQALINTIFVV
TCIIAILLWIIYCVFLKLRNKSH
NT seq 252 nt NT seq  +upstreamnt  +downstreamnt
atgaacttctcctttagttcctacccatattataacatgatcaagcacattgcaaacatg
aaacgattctcattatggtttacccatatcacattcattggcttattcttaatgtttcaa
ctcatcaaagattacttcagcagcgaaggacaggcgctaatcaacacaatttttgttgtc
acatgtatcattgccatattgttatggatcatctattgtgtattccttaaactaagaaac
aagtcacactaa

DBGET integrated database retrieval system