KEGG   Bacillus subtilis subsp. subtilis 168: BSU21000Help
Entry
BSU21000          CDS       T00010                                 

Gene name
yonT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EVC2_like ETRAMP 7tm_1 OAD_gamma
Motif
Other DBs
NCBI-GeneID: 939172
NCBI-ProteinID: NP_389983
Pasteur: BG13630
BSORF: BG13630
UniProt: O31941
Position
complement(2219784..2219960)
Genome map
AA seq 58 aa AA seqDB search
MLEKMGIVVAFLISLTVLTINSLTIVEKVRNLKNGTSKKKKRIRKRLRPKRQRQRIRR
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgagaaaatgggtatcgtagttgctttcctcatatctttaacggttcttacaatc
aacagtctaacaatagttgagaaggtaagaaacctaaagaatgggacaagcaaaaagaaa
aagcgtatacgcaagcggctccgaccaaagagacaacgccaacgtatacgccgatga

DBGET integrated database retrieval system