KEGG   Bacillus subtilis subsp. subtilis 168: BSU21010Help
Entry
BSU21010          CDS       T00010                                 

Gene name
yonS
Definition
(RefSeq) lipoprotein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF5067
Motif
Other DBs
NCBI-GeneID: 939171
NCBI-ProteinID: NP_389984
Pasteur: BG13629
BSORF: BG13629
UniProt: O31942
Position
complement(2220335..2220946)
Genome map
AA seq 203 aa AA seqDB search
MKLFKKLGILLLITSLILLAACKNSEESSSSSEDTNNATDTNTSESQDISVNGPEKVGDV
YEIDGGTAKVMAISNKETTVKTGPIQFTVKKVIAAVANEQLPFIDVQIESENTSDEVVRF
RPSLAQLATSTGVQIDEPSLLESDRLLDEYVGKVNDSGSIIYVFDNEEDIKDLESIRLRI
SSPFNEDLKNLGDKLDLKINLEH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtttaaaaaattggggattttactattaatcacttcactgatattgctcgca
gcttgcaaaaatagtgaagagtcttcttcatcatcagaagacacaaacaatgcaactgat
accaacacatcagaaagccaagacatctcagttaatggtcctgaaaaagttggggatgtt
tatgaaattgatggtggtacagctaaagtaatggccatcagcaataaagaaaccactgtg
aaaactggcccgatccaatttactgtaaaaaaagtaattgccgctgttgccaacgaacaa
ctaccttttattgatgttcaaattgaatcagaaaatacatctgatgaagtagttcgtttc
agaccaagtctagcacaattagcaacaagcactggggtacaaatcgatgagccatcattg
ttggaaagtgacaggcttctcgacgagtacgtaggaaaagtaaatgatagtggatccatc
atatatgtttttgataacgaagaggatataaaagatttagaatcaattcggctgagaatc
tcttctccatttaatgaggacttaaagaatttaggggacaagctagacttaaaaattaac
ttagagcattaa

DBGET integrated database retrieval system