KEGG   Bacillus subtilis subsp. subtilis 168: BSU21020Help
Entry
BSU21020          CDS       T00010                                 

Gene name
yonR
Definition
(RefSeq) XRE family transcriptional regulator
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_3 HTH_19 HTH_31 HTH_26 HTH_8 MqsA_antitoxin NanE
Motif
Other DBs
NCBI-GeneID: 939169
NCBI-ProteinID: NP_389985
Pasteur: BG13628
BSORF: BG13628
UniProt: O31943
Position
complement(2221061..2221387)
Genome map
AA seq 108 aa AA seqDB search
MFGERLKKCRTSKGYSQQRMADFLGITRQGYGKYEIGKAEPDLKTLTKLSNILGVSTDFL
LKGTHAQFDLDEILNDPETLIAGYNGMISEEQAKELLYYLLKKEFEEH
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagaacgtttaaaaaaatgccgtacctccaaaggatatagccagcaacggatg
gcggatttcttaggaattacgagacagggatatgggaaatatgaaattggtaaggctgaa
cctgatttaaaaacccttactaaattaagcaatatattaggagtatctactgactttctt
ctaaaaggcacacatgcacaatttgatctcgatgagatattaaatgatccagagacttta
attgctggatataatggaatgatctcggaagagcaagctaaagagttactgtattatctt
ttaaaaaaagagttcgaagaacattag

DBGET integrated database retrieval system