KEGG   Bacillus subtilis subsp. subtilis 168: BSU21030Help
Entry
BSU21030          CDS       T00010                                 

Gene name
yonP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prok_Ub
Motif
Other DBs
NCBI-GeneID: 939168
NCBI-ProteinID: NP_389986
Pasteur: BG13627
BSORF: BG13627
UniProt: O31944
Position
2222340..2222534
Genome map
AA seq 64 aa AA seqDB search
MQKDSEKVTYMFSNLIGFLETAIIEGTASQEENTLYEDYKLFGTIDKKSYTYKNLVHKYL
KSDY
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaggattcagagaaagtaacgtacatgtttagtaatttaattggatttttagag
actgctattattgaaggaactgcttcacaagaagaaaacactctttatgaggactataaa
ctatttggaacaatcgataaaaagagctatacatataaaaatcttgtacataagtatcta
aaaagcgattattaa

DBGET integrated database retrieval system