KEGG   Bacillus subtilis subsp. subtilis 168: BSU21040Help
Entry
BSU21040          CDS       T00010                                 

Gene name
yonO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2857
Motif
Other DBs
NCBI-GeneID: 939167
NCBI-ProteinID: NP_389987
Pasteur: BG13626
BSORF: BG13626
UniProt: O31945
Position
2222574..2225093
Genome map
AA seq 839 aa AA seqDB search
MKGKKDGLNKQVHIYSIDTSAFYNDQENKLHNKILKSYRYRDHLRKLEHVDKKHKKYITQ
RIISLKEKLYNAFNDHNQIRTLRTDSLKDNNVISLFDSVLTRTLGIKENSLSEEIMVVQT
YHFQILRDIIDKGFIHNNEKYVYFTSSAGQIRTKKSCFIKQSTLDKYQNALTCGLSVEHI
NAQGGSSINKWNSYMALSNSASSSWEIDIDKAIVVNDLETNVSSLVDYIDRDTYEITRKI
MDIPIEHTDGCGMMLPSLSQKSFMVRLPWVKGLLVPFDFRKFAEKHSSFIVKDVYGKEWD
IIKDDIQIIFTKSQFKMWKYYDSWDDYRYKFKKYGCLGAKLNEEDPSVEGKLTYQMLQTL
TDITDEELKQISSKTVSEITQLGTDKETMMKVLGATEKNKHKTSLQEALLIYPELLNDDH
TKEIIKNKKKSMIKDAKSGKLLVSDARYTYLCPDLYAFCERLFLGIESPKGLLSGSDVHC
SLYDEGYIDILRSPHLFREHGVRWNKKNEEYEKWFITPGVYTSIHDPISKLLQFDNDGDK
ALIISDELIVNIAKRNMADIVPLYYEMSVAQKQEINSRNIYEALTLAYGINIGEYSNNIT
KIWNSDNINLDVIKWLCMENNFTIDFAKTLFMPTRPDHVDEKIKDYIKNKVPHFFINAKD
KEEHSVESINESTVNKLDSIIPSDRINFAAVAGKFDYRFLLKNKEIKLNEAVINEYKRLD
RNKKWLMNDEEAKPGQKLYVYKIIKQKLLEIHNDDGFITDVLVKHLYKKKSKYKSTLWEC
FGDIVLENIKHNLKTFKGCCICGKAFKPTSNKAKYCQSCGKKKERDKYKKYNKKRINHR
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaggaaaaaaagacggcctaaataaacaagtacatatttacagtattgacacttct
gctttttataatgatcaagaaaacaaattacataacaagattttaaaatcatataggtac
agagatcatctcagaaaacttgaacatgttgataaaaaacataagaagtacataacgcaa
aggattatttccttaaaagaaaagctttataacgcctttaacgatcataatcaaataaga
acacttagaacagattctctgaaagataataatgtgatttcattatttgattcagtctta
actcgaacgctgggaatcaaagaaaactctctctctgaagagatcatggttgtccaaact
tatcactttcaaattttaagggacattattgataaaggattcatacataacaatgagaaa
tacgtttatttcactagcagtgccggtcaaataagaacaaaaaaatcttgttttatcaaa
caaagcaccttagataagtatcaaaatgctttaacttgtggtcttagtgtggagcatatc
aatgctcaaggtggaagcagcataaacaaatggaatagctacatggccttatcgaatagc
gccagcagttcatgggaaattgatattgataaagcaattgtcgtaaatgacttagaaaca
aatgtttccagcctagttgattatattgaccgggatacatatgaaatcacacgtaagatt
atggatattcctatagaacatacagatggttgtggaatgatgctccctagtttgagtcag
aaaagctttatggtcagattaccttgggttaagggtctacttgttccatttgactttaga
aagtttgctgaaaaacacagttcatttatagttaaagacgtctacggtaaagaatgggac
attattaaagatgatatccaaataatttttacgaaaagccagtttaagatgtggaagtac
tatgattcttgggatgattatcgctataaatttaaaaagtatggatgtttaggagctaaa
ttaaatgaagaagatccatctgttgagggaaaactgacttaccagatgctacaaacactc
acggatatcacagatgaggaattgaaacaaatcagctcaaagactgttagtgagattact
caattaggcactgataaagaaacaatgatgaaagttttaggggctaccgagaaaaataaa
cataagacaagccttcaagaagctctactaatatatcctgagctgctaaatgatgatcac
accaaagaaatcattaagaataagaagaagagtatgattaaggacgccaaatcaggaaaa
ttacttgtcagtgacgcccggtatacatatttatgtcctgacctatatgctttttgtgaa
agattgtttcttggaattgagagtccaaaaggactactttcaggaagcgatgtccattgt
tctttatatgatgaagggtatattgatatcctccgctcccctcacctattcagagagcat
ggtgttaggtggaacaagaaaaatgaggaatatgaaaagtggttcattaccccaggtgtt
tataccagcattcatgatccgatatccaagctgctgcagtttgacaatgacggggataag
gccttaattatttctgatgagctaatcgtcaatattgccaagcgtaatatggcggacatc
gttcctttgtattatgaaatgtctgtagcccagaaacaagagattaatagcagaaacatc
tatgaagcactaactcttgcttatggaatcaatatcggggagtacagtaacaacatcact
aagatatggaacagtgacaatataaacctggacgtgatcaaatggttatgcatggagaat
aactttactatcgattttgcaaaaaccttattcatgcccacccgccctgatcacgttgat
gagaaaatcaaagattacataaaaaataaagtgccccacttcttcatcaatgcaaaggat
aaagaagaacatagcgtagaatcgattaatgaaagtacagtaaataagttagactccatt
atcccttctgaccgaatcaactttgctgcagttgcaggaaaatttgattaccgcttctta
ctcaaaaacaaagagattaaacttaatgaagccgtaataaatgaatataaacgtcttgat
cgaaataaaaaatggcttatgaatgatgaagaagctaaaccaggacaaaaactttatgtc
tataagattatcaaacaaaaactattggaaatacataatgatgacggatttattacagat
gtattggtaaaacatctatataagaaaaaaagtaaatacaaatcgacactgtgggagtgc
tttggcgatattgtactggagaacattaagcataatttaaagacctttaaaggatgctgt
atttgtggaaaagcttttaagccaacatctaacaaagcgaagtactgtcagtcttgtgga
aagaaaaaagaacgtgacaaatacaaaaaatataacaaaaagagaattaaccaccgttag

DBGET integrated database retrieval system