KEGG   Bacillus subtilis subsp. subtilis 168: BSU21050Help
Entry
BSU21050          CDS       T00010                                 

Gene name
yonN
Definition
(RefSeq) DNA-binding protein HU 2
  KO
K03530  DNA-binding protein HU-beta
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bsu03032]
    BSU21050 (yonN)
   03036 Chromosome and associated proteins [BR:bsu03036]
    BSU21050 (yonN)
   03400 DNA repair and recombination proteins [BR:bsu03400]
    BSU21050 (yonN)
DNA replication proteins [BR:bsu03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    BSU21050 (yonN)
Chromosome and associated proteins [BR:bsu03036]
 Prokaryotic Type
  Nucleoid associated proteins
   HU (heat unstable protein)
    BSU21050 (yonN)
DNA repair and recombination proteins [BR:bsu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      BSU21050 (yonN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 HU-CCDC81_euk_2 HU-CCDC81_bac_1 SSPI DUF2267 MetW
Motif
Other DBs
NCBI-GeneID: 939170
NCBI-ProteinID: NP_389988
Pasteur: BG13625
BSORF: BG13625
UniProt: P68573
Position
2225337..2225615
Genome map
AA seq 92 aa AA seqDB search
MNKTELIAKVAEKQGVSKKEGAPSVEKVFDTISEALKSGEKVSIPGFGTFEVRERAARKG
RNPQTGEEIDIPATKAPAFKPAKALKDAVKAK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacagaactaatcgctaaagtggcagaaaaacaaggggtatctaaaaaagaa
ggagctcccagtgtcgaaaaagtctttgacactatttcagaggcattaaaaagtggagaa
aaagtaagtattcctggtttcggaacatttgaagttcgtgaacgcgcagctcgtaaaggg
agaaatccccagacaggagaggaaattgatattccggctacaaaagcacctgcatttaag
ccagcaaaagcacttaaagacgcagtcaaagctaaataa

DBGET integrated database retrieval system