KEGG   Bacillus subtilis subsp. subtilis 168: BSU21060
Entry
BSU21060          CDS       T00010                                 

Gene name
yonK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YonK
Other DBs
NCBI-GeneID: 939166
NCBI-ProteinID: NP_389989
Pasteur: BG13624
BSORF: BG13624
UniProt: O31947 A0A6M3ZI69
Structure
PDB: 
2H4O

Position
2227297..2227488
AA seq 63 aa
MASKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVK
GVE
NT seq 192 nt   +upstreamnt  +downstreamnt
atggcaagcaaaaaagtacatcaaattaatgttaaaggcttttttgatatggacgtaatg
gaagttactgaacaaactaaagaagctgaatacacatatgatttcaaagaaattctttca
gagtttaatggaaaaaatgtttcaattactgtaaaagaagaaaatgaacttcctgttaaa
ggcgttgagtaa

DBGET integrated database retrieval system