KEGG   Bacillus subtilis subsp. subtilis 168: BSU21070Help
Entry
BSU21070          CDS       T00010                                 

Gene name
yonJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939163
NCBI-ProteinID: NP_389990
Pasteur: BG13623
BSORF: BG13623
UniProt: O31948
Position
2227505..2228722
Genome map
AA seq 405 aa AA seqDB search
MIDPVQTKRHSDENLKEWKIRICSNKDIYNLNWEEIKELINKETGESKGESAYRKWFNNF
IEGVEYQRERSDESNNSLLELELKKVEIMEERKKLQAVKHEIHKNTRVKGRTELLYENVT
EAIEKVGTLPPPSFYPLNKNERKRAAVLGFGDEHFGKQFKSNNNEYNEQIYLQRMNQILS
ETVEYIQKENLDELVVLNGADSVEGMALRVSQLTALQYGFIDQVIKYSRYKAEWLLELSK
HVKIKYIHIPSANHTELRLHNTNRSEMPKEDVERIIATYIHDVLKDNERIEVPLYDEGIV
DFKLLEFEIVACHGHQIKNKKNAIRDISQMKRKFYDYMYISHFHHGNMLTVGEAATHNIQ
VIQLPSVMGSDEYSDSLMTGAKAGANLSIYESGKGRIIQYDYILN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcctgttcaaactaagcgtcactcagatgaaaaccttaaagaatggaaaata
agaatctgctctaataaagacatttataatctaaactgggaagaaatcaaagagttaatc
aacaaggaaactggtgaatctaaaggtgaatcagcttatagaaaatggttcaacaacttc
attgaaggagttgaataccaacgagaaaggtcagatgaatcaaataattctctccttgaa
ttggaactgaaaaaggttgaaatcatggaagagagaaaaaagcttcaagctgtaaagcat
gaaatacataaaaacacacgcgtcaaaggccgaacagagctgctatatgaaaatgtaact
gaagcaattgagaaagtaggtactctccctcccccttccttctatccattaaataagaac
gaaagaaaaagagctgctgttctagggtttggagatgaacacttcgggaagcaatttaaa
agcaacaacaatgaatacaacgaacagatttatttgcagcgtatgaatcagattctttct
gaaactgttgagtacattcaaaaagaaaatttagatgagctggtcgtgttaaatggtgct
gacagtgttgaaggtatggcattgcgcgtatcgcaattaactgcccttcagtacgggttt
attgaccaagtgataaaatactctaggtacaaagctgaatggcttttagaactttctaag
cacgtcaaaattaagtacatacatatcccttctgcaaatcatactgaactaagattacat
aatacaaatcgctcggaaatgcctaaagaagatgtagagcgtattatagctacttatatc
catgacgtactcaaagacaatgagcgaattgaagttcctttatacgacgaaggaattgtg
gattttaaattacttgaatttgaaattgtcgcatgtcacggacaccagattaaaaacaaa
aagaatgccattcgtgacatctcacagatgaaacgaaaattctacgattacatgtacatc
tcccacttccaccacggaaacatgctcactgtaggtgaagcagccactcataatatccaa
gttatacaactcccttctgtaatgggttccgatgaatacagtgacagcttaatgacaggt
gccaaagctggagcaaacctttcaatttatgagtccggtaaaggtcggattattcaatac
gattacatattaaattaa

DBGET integrated database retrieval system