KEGG   Bacillus subtilis subsp. subtilis 168: BSU21080Help
Entry
BSU21080          CDS       T00010                                 

Gene name
yonI
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp-FAR-1 NTS APG17
Motif
Other DBs
NCBI-GeneID: 939164
NCBI-ProteinID: NP_389991
Pasteur: BG13622
BSORF: BG13622
UniProt: O31949
Position
complement(2228756..2229166)
Genome map
AA seq 136 aa AA seqDB search
MENKVTLSDLVRKNIPVILKGSKHPLTEKELLEELAKKIPELVKNGEYRNGVLRGVLNKL
STQPVDRLGISREGNRVKYYFITDKKTELQNVIRNLISEIKEKELLTVDYLNDSPETIDF
IKDVSTHVKDLEGFTR
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacaaagttacattatcagatcttgtacgtaaaaatataccagtgattttaaag
ggttcaaaacaccctcttacagaaaaagagctgcttgaagaactagcaaaaaagatacct
gaacttgttaagaatggtgaatatagaaatggagttcttcgaggtgtattaaataaatta
tctacacagccagttgatcgattaggaatttcacgtgagggtaatcgagttaagtattat
ttcattacagataaaaaaactgagcttcaaaatgttattagaaatctcatcagtgagatt
aaagaaaaggaattattgacagttgattacttgaatgattcgcctgaaacaattgacttt
ataaaagatgtatctactcacgttaaagacttagagggatttacaagataa

DBGET integrated database retrieval system