KEGG   Bacillus subtilis subsp. subtilis 168: BSU21090
Entry
BSU21090          CDS       T00010                                 

Gene name
yonH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Terminase_6C KCTD4_C
Other DBs
NCBI-GeneID: 939160
NCBI-ProteinID: NP_389992
Pasteur: BG13621
BSORF: BG13621
UniProt: O31950 A0A6M4JHM5
Position
2229385..2229885
AA seq 166 aa
MTNEDFKYLNKHLETLAQLKQSGYKCDKEISTVISKLHKLMGLASKSKVNFYTLGSNVEN
ENIADYKIGVDSPKGNRLLIVDPRTDCTTVLLVNVKDSKFENIKRRIASQTFGYQADLLV
QILKEKRPDKLLIDTCGIGKGLMDMVIEKLKTQDIEMSPSGDLTYS
NT seq 501 nt   +upstreamnt  +downstreamnt
atgacgaatgaagactttaaatatctgaataagcacttagaaacacttgcccaactcaag
cagtctggatacaaatgtgataaagagatatctactgttattagtaaattacataaacta
atgggacttgcatcaaaatcaaaagttaatttttacactttaggtagcaatgttgaaaac
gaaaacattgctgattataaaataggcgtagattctccaaaaggaaataggttgttaatc
gttgatccccggacagattgtacaacagttttacttgttaatgttaaagactccaaattt
gaaaatattaaaagaagaatagcttctcagacattcggatatcaagcagacctattggtt
cagattttaaaagaaaaacgccctgacaaactgttgattgatacatgtggaattggtaaa
gggttaatggacatggtgattgaaaagttaaaaacacaagatatcgaaatgtctcccagt
ggtgatttgacctatagttaa

DBGET integrated database retrieval system