KEGG   Bacillus subtilis subsp. subtilis 168: BSU21110
Entry
BSU21110          CDS       T00010                                 

Gene name
yonF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Terminase_6N Helicase_RecD AAA_19 AAA_30 Terminase_GpA
Other DBs
NCBI-GeneID: 939161
NCBI-ProteinID: NP_389994
Pasteur: BG13619
BSORF: BG13619
UniProt: O31952 A0A6M3ZCM7
Position
2230895..2232664
AA seq 589 aa
MTSHKNFTTDRNKHSRGINIFKKGNNFKKKSKSERLMDGIGAWTSFYRANPHRFVKEYLG
ITLKLFQCILIYMMVHNHYFMYLASRGQGKTWLTSVYCCVQAILFPGTKIVIASGTKGQA
REVIEKIDDLRKESPNLRREIEDLKTSTNDAKVEFHNGSWIKIVASNDGARSKRANLLIV
DEFRMVDFEIISKVLRKFLTAPRSPKYLEKEEYAHLKERNKEIYLSSCWYKVHWSFNRFI
TYYNAMMKGSKYFVCGLPYQIAIKEGLLDKDQVRDEMAEEDFDPIGWSMEMEALWFGESE
KAYFKFEDIEKNRKLASPLFPPDYYSLIKDSNFKYEGKKPGEIRLVSNDIAGMAGKDNDA
SVYTVFRLIPNSNGYDRHIVYMESIVGGHTGTQATRIRQIYEDYDCDYIVLDTQSIGLGV
YDALCQPLYDKERAKEYEPFSCINDERMAARCTYQNAEKVIYSIKGNAQLNSEIAVLLKD
GFKRGKIKIPINENEGKEYLKRFKGYEGLSPEVKGKFLSSYAQITLLINEMINLEAEYSD
NGQVKLKEPKSKRKDRYSSVAYGNYIATVLERQLNKQTEYDVEDELVYF
NT seq 1770 nt   +upstreamnt  +downstreamnt
atgacctcacataaaaattttacaacagatcgcaacaagcacagtcgaggaatcaatatt
tttaaaaagggaaacaactttaaaaagaaatcaaaatctgaaagattaatggatggtatc
ggcgcatggacttctttctatagagcaaacccacatcgttttgtaaaagaatacttgggt
attacacttaaattgtttcaatgtattttaatttacatgatggtacataaccattatttt
atgtacctggccagtcgtgggcagggtaaaacttggctaacctctgtatactgctgtgtg
caagccatactcttcccaggtactaaaatagttatcgcatcgggcacaaagggacaagct
cgtgaagtcatagagaaaattgatgacttacgcaaagaatcacctaatttaaggcgagaa
attgaagatttaaaaacctcaacaaatgatgctaaagtggagtttcataatggcagctgg
attaaaatcgtagcctcaaatgatggcgcccgctccaagcgtgcaaacctccttattgta
gatgaattcagaatggttgattttgaaatcatcagtaaagtacttcgaaaattcctgaca
gctccccgttctcctaaatatctcgaaaaagaagaatacgctcacttaaaagaacgaaac
aaagaaatttacttgtcttcctgctggtacaaggttcattggtcatttaacagattcata
acttactacaatgccatgatgaaaggatcaaaatattttgtgtgtggtctcccttatcag
atcgcaattaaagaaggtcttttggataaagatcaggttagagatgaaatggccgaagaa
gactttgatcctatcggttggtctatggaaatggaagctctctggtttggtgaatctgaa
aaagcctattttaaattcgaagacattgaaaagaaccgcaagcttgcttctcccctcttc
cctcctgactattacagtctaatcaaggattccaacttcaaatatgaaggcaagaaacca
ggagaaattagactggtaagcaatgatatcgctggaatggccggtaaggataatgatgcc
agtgtttacactgtattcagactgattccaaactccaatggatatgatcgtcatattgta
tacatggagagcatcgtaggtggtcacacaggaactcaagcaacaagaattagacaaata
tacgaagattatgattgcgattatattgtattagatactcaaagtatcggacttggtgtg
tatgatgcattatgccagcctttatatgataaagaacgtgcaaaagaatatgagccattt
tcatgtattaacgatgaaagaatggctgcgcgttgtacttatcaaaatgctgaaaaagta
atttatagcattaaaggtaatgcacaattgaacagcgaaattgcggtattactaaaagat
ggattcaaacgaggaaaaatcaaaattcctatcaacgaaaatgaaggaaaagaatacctg
aaaagatttaaaggctatgaagggctatctcctgaagttaaaggaaaattcctttcaagc
tatgctcagattacccttctaataaatgaaatgatcaacttagaagctgaatatagcgat
aacggacaagttaagcttaaagagccaaagagtaaacgaaaagacagatatagctcagtg
gcttatggcaactatattgctactgtattagaaagacagttaaacaaacaaactgaatat
gacgttgaagatgaattagtctatttttaa

DBGET integrated database retrieval system