KEGG   Bacillus subtilis subsp. subtilis 168: BSU21120Help
Entry
BSU21120          CDS       T00010                                 

Gene name
yonE
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCM2_C
Motif
Other DBs
NCBI-GeneID: 939162
NCBI-ProteinID: NP_389995
Pasteur: BG13618
BSORF: BG13618
UniProt: O31953
Position
2232682..2234202
Genome map
AA seq 506 aa AA seqDB search
MVTLNKVDIESEEYKQMLNDYSTYTSTFASGFISNMFSNGIVTEIEAEQLKNYFSNPDEF
QEEIEDLAQYFYISTAEIHQLFELIEALPTLNYKIDSFNKVKSSDKHISLLNKSLHKVKH
KRLTRDLLKQVATAGTLVGIWLGDAKSPYPFIFDEIKYVFPSFRRNGDWVCVVDMELFTK
YKDDQRNELLKSLSPYIKQSDYENFMKDREKYRFKELPQERTFPLRTGTLKRNQGLGTSW
VTPGLYDVLHKKKLKDVERSIANKIINAVAVLTIGTDKGNGEYTNMKLPKAVKQKIHGGV
KTALEKNQKDGVTVVSIPDFADINFPDVKADGLDGAKFDHINSDIQSAYGLSGSLLNGDG
GNYATSSLNLDTFYKRIGVLMEDIEQEVYQKLFNLVLPAAQKDNYYMNYDKDKPLTLKEK
MDILIKLNDKGWSIKHVVDNLAGVSWESYLEQTLYETEELKLQEKIRPYQTSYTFTGNEV
GRPNEGNKNNDNTVKSATSNGNDNPI
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccttaaataaagttgacattgagtctgaagagtataagcaaatgctgaatgac
tattcaacttatacttctacatttgcttccggctttatctcaaatatgttttccaatggc
attgttacggaaattgaggccgaacaattaaagaattacttttctaaccccgatgaattt
caagaagaaattgaagatcttgctcagtatttttacatttcgactgctgagattcaccaa
ttgtttgaattgattgaagccctccctaccctcaactataaaattgactcctttaataaa
gttaagtcttcagataagcatatttcccttttgaataaatccttacataaggttaagcac
aaaagacttactagggatctgttaaaacaggtagctacagctggtactcttgttggtata
tggcttggggatgctaagagcccgtatccgtttatttttgatgaaattaaatatgtattc
ccctcctttagaagaaacggagactgggtatgtgtagttgacatggagctgttcactaag
tataaagatgatcaaagaaacgaattgttaaaaagcctctccccttatattaaacaaagc
gattatgaaaacttcatgaaagatcgagagaaatatcggtttaaggaattgccacaagaa
agaacttttccactacgcacagggacgctaaaaagaaatcaaggattgggaacatcttgg
gttacaccaggtctatatgacgttctccataaaaagaaacttaaagatgttgaaagatcg
attgcaaataaaattattaacgctgttgcagttctaacgattggaacagataaaggtaat
ggcgaatacacaaacatgaagctgcctaaagcagttaaacaaaaaattcatggtggcgtt
aaaacggctttggaaaaaaaccaaaaagatggagtgactgtagtatcaatccctgacttt
gctgatatcaattttccagatgttaaagcagatggattagatggagcaaaatttgatcat
atcaatagcgacattcaatctgcttacggattatccggctctcttttaaatggtgatggc
ggtaactacgcaacttcgtcattaaacttggatacattttataagcgtattggcgtttta
atggaggatattgaacaagaggtttatcaaaagttattcaaccttgttttgcctgctgcc
caaaaagacaattactatatgaattacgataaagacaagccgctcactcttaaagaaaaa
atggacatcttaattaaattaaacgataagggctggtctattaagcacgtagttgacaat
ttggcaggagtgtcttgggaaagttaccttgaacaaactctatatgaaactgaagagctg
aaactccaagaaaaaattagaccttatcaaacttcatataccttcactgggaatgaagtt
ggccgcccaaatgaaggtaataaaaacaacgacaacacagtgaagtcagctacatccaac
ggtaatgacaatcctatttaa

DBGET integrated database retrieval system