KEGG   Bacillus subtilis subsp. subtilis 168: BSU21130Help
Entry
BSU21130          CDS       T00010                                 

Gene name
yonD
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MscS_porin DUF1043 Atg14 Sec34 DUF3251 Phage_GPO NPV_P10 Laminin_II
Motif
Other DBs
NCBI-GeneID: 939159
NCBI-ProteinID: NP_389996
Pasteur: BG13617
BSORF: BG13617
UniProt: O31954
Position
2234233..2235669
Genome map
AA seq 478 aa AA seqDB search
MTKKQKKKLCQLQLNEIKTSDDPTKLSCSFVIFDFDVSHNNTVISKDVALEAASTIINKP
IVAKYYEVDELNTSTDALGTHEAYLDTDKHGELEVKRDTAPIGVFTSEGYITEIETPDGK
KEVLAADAILWSSRFKDACELLLEWYGRGININTSCEILYSNYTVQDGIEHLQSPIYFEG
HAILNSEKRGEHDIVLPAYDSSKLLSFNELQRFERLVAQAATRQNNEEGEKMNKFRKVFE
LSHSDVRTLLYSQLDPTLDKESDSFIADVYDTYFIVNVYSWSDENSYDKYFKFNYTRTGD
TVSIDFDSKTEVFMTRNWEEVVPEPIQSQLNQKDEQIKDLTKQVNQINKDKVGIEQQFNT
ASEKLVQLNSEVEQLKPYKEKHEKTLLEQKLSEKNEFYKAKFEALNAEEKFSTEEVQNLI
HASVKQDEEGEKAVLQLNTMLVDLVSVPTETNTTIREFSSKRENLIPNDDSFESRFSQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
ttgacaaagaagcaaaagaaaaaactatgccaacttcaattgaatgagattaaaacatca
gatgacccaacaaagttgtcatgtagctttgtcatttttgatttcgatgtctctcacaat
aatacagtaatttctaaggatgttgctcttgaagctgcttcaacaattattaataaaccg
attgttgcaaaatattacgaggttgatgaattaaatacttctacagatgcattgggaact
catgaagcttatctagacacagataagcacggagaacttgaagtaaaaagagatactgcc
ccaatcggtgtctttacatccgagggatacataactgaaattgaaaccccagatggcaaa
aaagaagtattggcagcagatgcaatactttggagctctcgatttaaagatgcatgtgaa
cttttacttgaatggtatggtagaggcatcaacattaatacaagttgtgagatcctttat
tcaaattacactgtgcaagatggtatcgaacacctacagtcccccatctatttcgaaggt
catgcaattttaaattcagagaaacgtggagagcatgacattgtcctccccgcctatgat
tcttccaaacttctaagctttaatgaacttcaacgatttgaaagattagtggctcaagca
gctacaagacaaaataatgaggaaggtgaaaaaatgaataagtttagaaaagtgtttgaa
ttgtctcactctgacgttcggacgcttctatatagccaattagatccaacccttgataaa
gaatcagattcatttattgcagatgtatatgatacgtatttcatcgtaaacgtgtatagc
tggtcagatgaaaatagctatgacaaatactttaagttcaattacacaagaacaggcgat
actgtttcaattgattttgacagtaaaactgaggtattcatgacgcgcaactgggaggaa
gttgttcctgagcctattcaatcacaacttaaccagaaagatgaacaaattaaagattta
acgaaacaagtaaatcaaatcaataaggataaggtaggaattgaacagcaattcaacact
gccagtgaaaagcttgtgcaattaaattctgaagtggaacaattgaagccttataaagaa
aaacacgagaaaactttattagagcaaaaactaagtgagaaaaatgaattctataaagcg
aaatttgaagctttaaatgctgaggaaaaattcagtacagaagaagtacaaaaccttatc
catgcttcggttaaacaagatgaagaaggagaaaaagctgtattacaacttaacacaatg
ttagttgatttagttagtgttcctactgaaacaaatacaaccattagagaattttcaagt
aaacgggaaaatttaatccctaacgatgactcttttgaatcacgcttttcacaataa

DBGET integrated database retrieval system