KEGG   Bacillus subtilis subsp. subtilis 168: BSU21140Help
Entry
BSU21140          CDS       T00010                                 

Gene name
yonC
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PBP-Tp47_a RNase_PH_C
Motif
Other DBs
NCBI-GeneID: 939157
NCBI-ProteinID: NP_389997
Pasteur: BG13616
BSORF: BG13616
UniProt: O31955
Position
2235694..2236230
Genome map
AA seq 178 aa AA seqDB search
MATRLQKALTEVGNHTTGNLNSLKIKTVAHGAKVTGSDIDNFMLVELGFDAEGNRTASKL
SDKTKKAYLIASPEARYLGESMRDFYNGVGEHARIVILEPAYTRFDVSAFSFNTGVTEVK
QGQVAHFDIATQKYILSDPTSPHEDYADSSAKFLVVNNEDDLVYTMGQKLVRLEVIEA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggctacaagattacaaaaagcccttactgaagtaggtaatcatactactggaaacttg
aattctttaaaaatcaaaacagttgctcacggtgcaaaagtgactggttcagacattgat
aactttatgcttgttgaacttggttttgatgctgaggggaaccgtacagcttcgaaacta
tcagataaaacaaaaaaagcatatttaattgcatctcctgaagcacgctaccttggtgaa
tcaatgagagatttttataacggtgtaggagaacatgctcgaattgttatccttgagcca
gcttatactcgttttgatgtttctgcattttcatttaatacaggagtgactgaggttaaa
caaggtcaagtggctcactttgatattgctactcaaaagtatattcttagtgatcctact
tcacctcatgaggattatgctgattcttctgctaagttcctagttgtaaataatgaagat
gaccttgtttacacaatgggacaaaaacttgttcgccttgaagtaatcgaggcctaa

DBGET integrated database retrieval system