KEGG   Bacillus subtilis subsp. subtilis 168: BSU21150Help
Entry
BSU21150          CDS       T00010                                 

Gene name
yonB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939155
NCBI-ProteinID: NP_389998
Pasteur: BG13615
BSORF: BG13615
UniProt: O31956
Position
2236269..2237285
Genome map
AA seq 338 aa AA seqDB search
MKLDTVKIKGLFSRVLNNKMDGTDKADIQTYIKKVFGDGGTTPDPSMLHQFNNLVVEQAD
EIAKPKVTQLLSLLANVQQEKRGNIKEIKIPKKNKAKVIWSATGSGVDLVRVEGQETVPA
VPKTMSTGFYYEPLDLVTDSIVYFNKLVNDIADAKVRLYLDKIHQLTASAITAGKIPAKN
VQTGSNLTLQQYNKVASVLQRYGGKPIFVADTLLIDYFAFQQGTDSTFKNFLTEEVKGEL
LTALNPTTIGRTTAVNLTNPFTDDTNSKVELPVNKGYMFAGGVSQKPFSVVEYGGLRQLT
EQDIEDERIKMKIVQDASVNLLFGEAIGIIEEQAAVSI
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagatactgtgaaaatcaaaggcttgtttagccgtgtattaaataacaaaatg
gacggtacagacaaagctgatatccaaacttacattaagaaagtgtttggtgatggcggt
actacacctgacccttccatgctccatcaatttaataaccttgtcgttgaacaagctgat
gaaattgcgaaaccaaaagtaacacagctcctctcccttctggccaatgtccaacaagaa
aaacgaggcaatattaaagaaattaaaattccaaaaaagaataaagcaaaagtcatttgg
tctgctacaggctctggtgttgatttagttcgtgttgaaggacaagaaacagttcctgct
gttccgaaaactatgtcaacaggtttctattatgaacccctagatctcgtaacagattca
attgtttacttcaataaattggtgaatgatatcgcagatgctaaagtccgtttgtacctc
gataaaattcatcaattaactgcaagcgcaattacagctggtaaaatccctgcaaaaaat
gttcaaacaggctcaaaccttactcttcaacaatacaacaaagtagcttccgtgcttcaa
cgttatggtggaaaaccaatcttcgtcgctgacactcttctcattgactacttcgcattc
caacaaggaacagactctacgtttaagaacttcttaacagaagaagtaaaaggagagctc
cttactgctctaaatccaacaactatcggaagaacaactgctgttaacctcactaaccca
tttacagatgatacaaatagtaaagtcgaacttcctgtcaacaaaggttatatgtttgcc
ggcggcgtttctcaaaaaccattttctgttgttgagtatggcggactgcgtcaattgaca
gaacaagatatcgaagatgaaagaatcaaaatgaaaattgttcaagatgcttctgttaac
cttctttttggagaagcaatcggaattattgaagaacaagctgcagtatctatctaa

DBGET integrated database retrieval system