KEGG   Bacillus subtilis subsp. subtilis 168: BSU21160
Entry
BSU21160          CDS       T00010                                 

Gene name
yonA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939158
NCBI-ProteinID: NP_389999
Pasteur: BG13614
BSORF: BG13614
UniProt: O31957 A0A6M3ZI80
Position
2237321..2237791
AA seq 156 aa
MTEKIKLARYRSTSYFVGYTGDGGHKQYTWSGSKNGKADIKEVPKEVVEWLTMNSVCFDK
GELVIVEDNETTKEIKDSIVESEAYENNIHTKEEIEKMIKSGNIAQLKNKLDKITVDSEK
QFIIDVASEFSDDIAAGKLKVLADWMGVADPSLLFD
NT seq 471 nt   +upstreamnt  +downstreamnt
ttgactgaaaaaattaagttagcacgatacagaagtacgtcttattttgttgggtatacc
ggcgatggtggacataaacaatacacttggtctggtagtaaaaatgggaaggctgatatt
aaagaagttccaaaagaagttgttgaatggctcacaatgaacagcgtttgtttcgataaa
ggtgaattagttattgttgaagataacgagacaaccaaagagattaaagattctattgtt
gagtcggaggcttatgaaaataacattcataccaaagaagaaattgaaaagatgattaaa
tcgggaaatattgctcaactaaaaaataagctcgataaaatcacagtggattctgagaag
caatttattattgacgttgcttcagaatttagtgatgacattgctgcaggcaaattaaaa
gttttggctgattggatgggagtcgctgatccttcccttctctttgactaa

DBGET integrated database retrieval system