KEGG   Bacillus subtilis subsp. subtilis 168: BSU21170
Entry
BSU21170          CDS       T00010                                 

Gene name
yomZ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5713 GPW_gp25 DUF5846
Other DBs
NCBI-GeneID: 939156
NCBI-ProteinID: NP_390000
Pasteur: BG13613
BSORF: BG13613
UniProt: O31958 A0A6M3ZCC0
Position
2237806..2238201
AA seq 131 aa
MTSYDQIWETFLNNCETSDFDVPQQEEDIYKSIRNAILHFNNRLRDNLKADNSTETVNRE
LSEDDLLILAHFLRYIFLLNKKTLFENTWQPFTNDVGIKNFGTQLNSLKQSVMDQKDEIE
RLILNAAVDYL
NT seq 396 nt   +upstreamnt  +downstreamnt
atgacatcttatgatcaaatatgggaaacctttttaaacaactgcgagacgtccgatttt
gatgttcctcaacaagaagaggacatttataaatcaattcgaaatgcaatccttcatttc
aataaccggcttagagacaatttaaaagctgataattcaactgaaactgttaatcgagaa
ttatctgaggatgatcttcttattcttgcacacttcttgagatacatctttttgttaaat
aaaaagaccttgtttgagaatacgtggcagcccttcacgaatgacgtggggatcaagaac
tttggtacgcaactcaattcacttaaacaaagtgtaatggatcagaaagacgaaattgag
cgcttgatattgaacgctgcggtggattatctatga

DBGET integrated database retrieval system