KEGG   Bacillus subtilis subsp. subtilis 168: BSU21180
Entry
BSU21180          CDS       T00010                                 

Gene name
yomY
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF1129
Other DBs
NCBI-GeneID: 939154
NCBI-ProteinID: NP_390001
Pasteur: BG13612
BSORF: BG13612
UniProt: O31959 A0A6M3ZCF3
Position
2238198..2238452
AA seq 84 aa
MSTIKVKSAHKDGQIKLEDLDVVCNKLCKRNNSVLFKLEKYLNKKLLSDPELTEIRDTIL
TVSGELSRLRDNLVTDGDSNEGLQ
NT seq 255 nt   +upstreamnt  +downstreamnt
atgagtacaattaaagttaaatcggcacataaagatggacaaataaagcttgaggactta
gatgttgtttgcaataaactgtgtaaaagaaacaattcagtcctcttcaaattggagaaa
taccttaataaaaagctgctaagtgatcctgaactcacagaaatcagggacactatttta
acagtaagtggtgaattaagcagacttagggataacttagtaacagacggtgattcgaat
gaaggactacagtaa

DBGET integrated database retrieval system