KEGG   Bacillus subtilis subsp. subtilis 168: BSU21190
Entry
BSU21190          CDS       T00010                                 

Gene name
yomX
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939153
NCBI-ProteinID: NP_390002
Pasteur: BG13611
BSORF: BG13611
UniProt: O31960 A0A6M4JHN3
Position
2238436..2239086
AA seq 216 aa
MKDYSNYHKVNINNKLLHDGKLIFQQGLKGFESEKVTIDGIEKTVMITSKYSSGDGSARY
ILGEIADIYRGGVVKFNDETWLITSHPLSNKIYKKAEIKICGTSFFLTSEDKLIDTGKIN
EITGKPIYEKVPGEKTEVPCIFERTTSINGTELAVNLPDGQANITIPYLVHEKLKIGLTL
TFFGEDYQVDDIDYSKVYGDHGTIKLVAKKKVGEKT
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaaggactacagtaattaccacaaggttaacattaataataaacttcttcatgatggt
aagcttattttccaacaaggccttaaggggtttgaatctgaaaaagtcacaattgatgga
atcgaaaaaacagtaatgatcacttctaagtactctagtggcgatggttctgcaagatat
atattaggtgaaattgctgacatttatcgtggcggagttgttaagtttaatgatgaaaca
tggctcatcacctcccaccctctcagtaataagatttacaaaaaggctgagataaaaata
tgtggaacatcattttttcttacttcagaagacaagctaatcgatactggcaaaattaac
gaaatcactggtaagccaatttatgaaaaagtacctggcgaaaaaactgaagtcccctgc
atattcgaaaggacaacttcaataaatggcactgaattggcggtaaatcttcctgatggt
caagcaaacattacaattccttatcttgttcatgaaaaattgaaaatcggacttaccctc
accttctttggcgaagattatcaagtcgatgatatagactattctaaagtttatggagac
cacggaacaataaaattggttgccaaaaagaaagttggtgaaaagacatga

DBGET integrated database retrieval system