KEGG   Bacillus subtilis subsp. subtilis 168: BSU21200
Entry
BSU21200          CDS       T00010                                 

Gene name
yomW
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939150
NCBI-ProteinID: NP_390003
Pasteur: BG13610
BSORF: BG13610
UniProt: O31961 A0A6M4JJS8
Position
2239083..2239589
AA seq 168 aa
MSMTVEQMTKVFRLVMDDVELNRLLYYKTDPLSPSHPDVQSLENYYDSTNDSPAIINTIF
KRAPKTDDLSDSPLCRMCIYLGNALPKPTNQSFMLLNQELMIDVYTHINTFEISEYRSLK
IIDRVSKLFFNKNIAGFGVTVDYKRLLISNPPDGYLGYKMIFTFGASK
NT seq 507 nt   +upstreamnt  +downstreamnt
atgagcatgactgttgaacagatgacaaaagtcttcagattagttatggatgatgttgaa
ctgaatcggctcttgtattacaaaactgatcctctctccccttctcatccagatgttcaa
tcactcgaaaattattatgactccacaaatgactctcccgctataatcaataccatattc
aagcgagcacctaaaacagatgatctatcggattcaccattatgtaggatgtgtatttat
ttagggaatgcattgcctaagccgacaaaccaaagctttatgttgttaaatcaagaattg
atgatcgatgtatacacacacattaatacatttgagatatctgagtatcgaagtttgaaa
atcatcgacagggtttcaaaattatttttcaataaaaatattgctggttttggtgtaaca
gtagattataaacgtttgcttattagtaatccccctgacggatatttgggctacaagatg
atctttacttttggagcaagtaaatga

DBGET integrated database retrieval system