KEGG   Bacillus subtilis subsp. subtilis 168: BSU21210
Entry
BSU21210          CDS       T00010                                 

Gene name
yomV
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Herpes_BBRF1
Other DBs
NCBI-GeneID: 939149
NCBI-ProteinID: NP_390004
Pasteur: BG13609
BSORF: BG13609
UniProt: O31962 A0A6M3ZCP1
Position
2239586..2240296
AA seq 236 aa
MNELKDFFFLGKPIQTEIGEIDFIRLKDYPLYTKELSMLRMNKKSLIKEYSRFNEDGSLD
PFIIEMKKRDLYEIVHSVLPDFHEAYFKVFSKVLINKDSLSLIGKHNFPRLRKLILDMHC
ITEDKVVDNDELQEFHDISKSLKQQDSQSDLKDIVSCVAAFNGYTYEEISEMTMYQLYLS
FYRMAEVMNYNTTTLFATVSPDVKVSDWSSHINLYKEESYHLSTKDAKNIEQLFGG
NT seq 711 nt   +upstreamnt  +downstreamnt
atgaatgagttaaaggatttctttttcttaggaaaaccgatccagactgaaataggagag
attgatttcatccgcttaaaagattatcctctctacaccaaagaactaagcatgttgagg
atgaataagaaaagtcttattaaagaatattcaaggtttaatgaggatggctcgcttgac
ccatttattattgaaatgaaaaagagagatctttatgaaattgtacattcggtactccct
gattttcacgaggcttatttcaaagttttttcaaaagtattgataaacaaggattcccta
tcgttgattggaaaacataattttccccgtctccgaaaactaatactagacatgcattgt
atcactgaagacaaggtcgttgacaatgatgaacttcaggagttccatgatataagtaaa
tcactcaagcaacaagattctcaaagtgatttaaaggatatagtaagctgtgttgctgca
tttaacggatacacgtatgaagaaatatctgaaatgacgatgtatcaactatatttgtcg
ttctacaggatggctgaagttatgaattataacacaaccacactttttgctaccgtctct
cctgatgtcaaagtaagtgattggagtagtcacattaatctttacaaggaagagtcttat
cacctgagcactaaagatgctaaaaatatcgagcaattatttggaggctaa

DBGET integrated database retrieval system