KEGG   Bacillus subtilis subsp. subtilis 168: BSU21220
Entry
BSU21220          CDS       T00010                                 

Gene name
yomU
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: ORF6N
Other DBs
NCBI-GeneID: 939146
NCBI-ProteinID: NP_390005
Pasteur: BG13608
BSORF: BG13608
UniProt: O31963 A0A6M3ZC28
Position
2240339..2241136
AA seq 265 aa
MAKQTVIHEVGKITAKRLSDNKVIASGVTQMTQFSQQVQQDFLKGGWGNRDLYVINSSKE
VSGNVRNAFFDLDFMAMQQGVKIENETISVWEDESLTVSDTGTVILSYLPLSKVSLTNED
GDQIEVDAASKTVTVPDTFATKGEALAVHYQIEVEAETVEINGEKFSENYYFEIHTIEYD
PKTSKIYSDLYIQLPKVNFSGEADMSFEAGNAYTPEIGYRALADNNGKIGNFARVKRKAD
GTKGVVTSDEGTGSSQSSDLGGTTE
NT seq 798 nt   +upstreamnt  +downstreamnt
ttggcaaaacaaacagtaatccatgaagttggaaaaattacagctaaacgtctgagcgat
aataaggttattgcttcaggtgttacacaaatgactcagttttcccaacaagttcaacaa
gactttttaaaaggcggatggggtaaccgagacctgtatgttattaattcaagtaaagaa
gtatcgggtaatgtccgaaatgctttctttgatcttgatttcatggcaatgcagcaaggt
gtaaaaattgaaaacgaaacaatttctgtgtgggaagatgaaagcttaacagttagtgat
actggtacggttatcctttcatatctcccattgtctaaagtttcattaactaacgaagat
ggagatcaaattgaagttgacgctgcatctaaaacagttactgtgcctgatacctttgca
accaagggtgaagctttagcagttcattatcaaattgaagttgaagccgagactgttgaa
attaacggtgaaaaattctctgagaattactactttgaaattcacacaattgaatacgat
cctaagacttcaaaaatctacagtgacctttatattcagctccctaaagtaaacttctct
ggtgaagcagatatgtcgtttgaagcaggaaatgcatacactccggaaatcggctatcga
gcccttgctgataataacggaaaaatcggtaactttgctcgtgtaaaacgtaaagctgat
gggacaaagggcgttgtcactagtgatgaaggaactggctcatctcaaagctcagatctt
ggcggaacaactgaataa

DBGET integrated database retrieval system