KEGG   Bacillus subtilis subsp. subtilis 168: BSU21229Help
Entry
BSU21229          CDS       T00010                                 

Gene name
youA
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8302922
NCBI-ProteinID: YP_003097751
UniProt: C0H440
Position
2241154..2241765
Genome map
AA seq 203 aa AA seqDB search
MAFLNQDGDKYTSAKDDGTGNPITAVSIERSTVPLEVGLNNDQPLNVNVANTALDVNITN
TASVPVLVKNTAAIKTQVQKSYSEFVVTDADTVATGATKSYTVDLIDSLGVFRTYGVAMY
TTQTDSSNSKVLASIYSVPKNIPFYSATTSGNDNSVLFNSIVFVQNYPLQKQLTFTAPKI
HLTVKAAGTVDLTGLKIVVWGME
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
attgcttttttaaaccaggacggtgataaatacacctctgcaaaagatgatgggacaggt
aatcccataacagctgtatcaattgaacgttccactgtccccttggaggttggtctcaat
aatgaccagcctcttaatgttaatgtggccaacactgcacttgatgtaaatataactaat
acggcttctgtccctgttttggttaaaaacactgcagcaattaaaacccaagttcaaaaa
tcctattctgaatttgttgttactgatgctgataccgtagctacaggtgcaactaagtct
tatacagttgatctaatcgattcacttggtgttttcagaacttacggtgttgctatgtac
acaactcaaacagacagctcaaacagcaaagttttagcaagtatttattccgtaccgaaa
aacatcccattttattctgcaactacatcaggtaatgataattctgttctattcaacagc
attgtttttgttcagaattaccctttacaaaaacaattaactttcactgctccaaaaata
catctgacagttaaagcagccggtacagttgatctaactgggttaaaaatcgttgtttgg
gggatggaataa

DBGET integrated database retrieval system