KEGG   Bacillus subtilis subsp. subtilis 168: BSU21230Help
Entry
BSU21230          CDS       T00010                                 

Gene name
yomT
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939151
NCBI-ProteinID: NP_390006
Pasteur: BG13607
BSORF: BG13607
UniProt: O31964
Position
2241765..2241992
Genome map
AA seq 75 aa AA seqDB search
MTFDEVCGLFKQFDGLEQKFLLLSDGSYISVDDFKQRFEGDFNEYEPLSSLQSSPSSTPA
WEGIWNKLQEDGLFE
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgacatttgatgaagtatgtggtctgttcaaacaatttgatggtttggaacaaaaattc
ctattactatcagatggatcctatatcagtgttgatgatttcaagcaacgctttgaaggc
gacttcaatgagtacgaacctttaagttcgcttcagtcatccccttcctctaccccagct
tgggaaggtatatggaataagctacaagaggatgggctttttgaataa

DBGET integrated database retrieval system