KEGG   Bacillus subtilis subsp. subtilis 168: BSU21240Help
Entry
BSU21240          CDS       T00010                                 

Gene name
yomS
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CHB_HEX_C_1
Motif
Other DBs
NCBI-GeneID: 939152
NCBI-ProteinID: NP_390007
Pasteur: BG13606
BSORF: BG13606
UniProt: O31965
Position
2242056..2242412
Genome map
AA seq 118 aa AA seqDB search
MTETTENVVITIPDKTSFTFHEAATSPSEGEEFVVGHFRELTVKISGSSTSREIKFYAVD
ENGEKTALSGTNKTDFQLGSSTLNTNEYWDFDIAGLFKVMFEVVSVTGDVTVKGIVVS
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
ttgacagaaacgactgaaaatgtcgtaatcacgattccagacaaaacttcatttacattt
cacgaagccgcaacttccccatctgaaggtgaagaatttgtagtgggtcattttcgggaa
cttactgttaagatctctggttcctcaacttcacgagaaataaagttttatgcagttgat
gaaaatggcgaaaaaactgcacttagtggcaccaataaaacagacttccaacttgggagc
agtactttaaatactaatgagtattgggacttcgacattgctggattgtttaaagttatg
ttcgaagtagtttctgttactggtgatgtaactgttaaagggattgtggtgagttaa

DBGET integrated database retrieval system