KEGG   Bacillus subtilis subsp. subtilis 168: BSU21250
Entry
BSU21250          CDS       T00010                                 

Gene name
yomR
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: UPF0225
Other DBs
NCBI-GeneID: 939147
NCBI-ProteinID: NP_390008
Pasteur: BG13605
BSORF: BG13605
UniProt: O31966 A0A6M4JHZ1
Position
2242414..2243631
AA seq 405 aa
MSSSKYVGQLKQNNIQINSLRGSNDRAEKHMLEHEQALTEKTNLFMEYQQNELKKHTDDK
SNPHLVTKEQVGLGNVLNNVQATKEEFDEHLNDTLNPHSVTKSQVGLANVLNEKQATKTE
FDQHAQDTIIHITASERTTWNAAESNSKKYTDAHSQNTNNPHKVTAIQVGLGNLTNDKQA
TKLEFDAHIKDNERHITSTERSKWNSAQLTKISSDDGQPLVSITSDFHSELLNSPTLTYF
GYDKAALEAPPSNGRGFWTCSADKLYGQAIVLTNDNKTYRKSLINGAWSSWERLISSSEI
DNVPWLSVTYKNGAKTGSRPLQYRKVAGTLQLSGHVVTNRDVVFASIPTEFSPTQGAVKS
VEVSGTFGRSKLFVNSNGDLQLSGVSADNSAAITGYYIDVVVPLN
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgagcagcagtaaatacgtcggtcaactcaaacaaaacaatattcagatcaattcatta
agaggatccaatgacagagctgaaaaacatatgcttgagcatgaacaagcattaacagaa
aaaacaaatttgtttatggaatatcaacagaatgagctcaagaaacatactgatgataag
tctaatcctcatttagtcaccaaagagcaggttggtttgggcaatgttttaaataatgtc
caagcaactaaagaggaatttgacgaacatctaaacgatactctcaatccccattcagta
actaaaagccaagttggtttagcaaatgtcctgaatgaaaaacaagcaactaaaactgaa
tttgatcaacatgctcaagatacaattattcatattacagcttcagagagaactacttgg
aatgccgcggaaagcaattctaaaaagtatactgacgcacattctcagaacacaaacaat
cctcataaagtaactgcaattcaggtcgggttaggaaaccttacgaatgataaacaagcg
acaaaattagaatttgatgctcacataaaagataatgagcgtcatatcactagcactgaa
agaagtaaatggaattctgctcaattaactaaaatatcaagcgatgatggtcaaccacta
gtttctataacaagcgactttcattctgaacttttgaattctcctactttaacatatttc
ggatatgataaggctgccttagaagcacctccaagtaacgggcggggattttggacatgt
agtgctgataaactttatggtcaagctattgttctgactaatgataataagacttacaga
aaatcattgataaacggagcatggtcaagttgggaacgattgataagtagcagtgaaatt
gataacgtgccttggttaagcgttacatataaaaatggcgcaaagacaggctcaaggcca
cttcaatatcgtaaagtagctgggactttgcagcttagtgggcacgttgtaacaaaccga
gatgtagtatttgcttctattccaactgaattttctccaacacaaggtgctgttaagtct
gttgaagtgagtggaactttcggcagaagtaaattatttgtaaactctaatggtgacctt
cagctaagtggggtatcagctgacaacagtgctgcaataacgggttactacatagatgta
gttgttccgttgaattag

DBGET integrated database retrieval system