KEGG   Bacillus subtilis subsp. subtilis 168: BSU21260
Entry
BSU21260          CDS       T00010                                 

Gene name
yomQ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 939142
NCBI-ProteinID: NP_390009
Pasteur: BG13604
BSORF: BG13604
UniProt: O31967 A0A6M4JND7
Position
2243642..2243992
AA seq 116 aa
MIQVYKYDENFMFVEPLVVTEIDEKGDYIFPDNCTSVPLPDSPSYYLPRFDLSKQVWIET
ASQEYIDSLSPPPEEPSDVELLGQSLAEARILILKQNRIILNLQNEVKNLKDGTTA
NT seq 351 nt   +upstreamnt  +downstreamnt
gtgatacaagtctataaatatgacgaaaattttatgttcgttgaacccctagttgtaact
gaaatcgatgaaaagggagattatatttttcccgataattgcacttctgttccattacct
gactctccctcctattaccttccacgatttgatttatcaaaacaagtttggatagaaaca
gcctctcaagaatatatagacagcctctcaccgccccctgaagaaccttctgatgtggaa
ttacttggacaatcactagctgaagccagaattttaattttaaaacaaaatcgcataatc
ttaaatttacaaaatgaagttaaaaacttgaaagatgggacaacagcatga

DBGET integrated database retrieval system