KEGG   Bacillus subtilis subsp. subtilis 168: BSU21270
Entry
BSU21270          CDS       T00010                                 

Gene name
yomP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Phage_XkdX
Other DBs
NCBI-GeneID: 939148
NCBI-ProteinID: NP_390010
Pasteur: BG13603
BSORF: BG13603
UniProt: O31968 A0A6M3ZCD0
Position
2243989..2244180
AA seq 63 aa
MSNFWVIALNKNWATLDQVKEAYYYDDVTKEELKEGVDNNLITPEQYQEIVGEAYTSVTL
STE
NT seq 192 nt   +upstreamnt  +downstreamnt
atgagcaatttttgggttatagccctaaacaaaaactgggcaactcttgatcaggttaaa
gaagcttattattacgatgatgtaactaaggaagaactcaaagaaggagtagacaataac
ttaattactcctgaacaatatcaagaaattgttggggaagcctatacttcagttacctta
tctacagaataa

DBGET integrated database retrieval system