KEGG   Bacillus subtilis subsp. subtilis 168: BSU21280Help
Entry
BSU21280          CDS       T00010                                 

Gene name
yomO
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939140
NCBI-ProteinID: NP_390011
Pasteur: BG13602
BSORF: BG13602
UniProt: O31969
Position
2244230..2244730
Genome map
AA seq 166 aa AA seqDB search
MASKKLNLSLIEESVNKYDKKEKVQLTDDVHVFIYPYFSPSRLTKMLTEMISDQQKAEDK
GIDFSKINTVQWVFFSIVKEFSDLGIPNDIKNKVKWYLKLVDSEFFPMIINSFPKESMKK
LKDATKALEKITEDLLTMSHQEINKLILEKVEEIETGSGEVSGENN
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaaaaaattgaatttaagtttaattgaggaaagtgtcaataagtatgacaag
aaagaaaaagtccaattaaccgatgatgtacatgtattcatctacccatacttttctcct
tctcggttaacaaaaatgctaactgaaatgatctctgatcaacaaaaagctgaagataaa
ggtattgattttagtaaaatcaacactgttcaatgggtattcttttcaattgtcaaagaa
ttttcagatttggggattccgaatgacatcaaaaataaagttaaatggtaccttaagctt
gtagattccgaattcttccctatgattattaacagttttccaaaagaaagtatgaagaag
cttaaggatgcaacaaaagctttagaaaaaatcactgaagacttgttaactatgagccac
caggaaatcaacaagcttattctagaaaaggtagaagaaatagagactggttctggtgaa
gttagtggcgaaaacaattaa

DBGET integrated database retrieval system