KEGG   Bacillus subtilis subsp. subtilis 168: BSU21290Help
Entry
BSU21290          CDS       T00010                                 

Gene name
yomN
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939144
NCBI-ProteinID: NP_390012
Pasteur: BG13601
BSORF: BG13601
UniProt: O31970
Position
2244714..2245133
Genome map
AA seq 139 aa AA seqDB search
MAKTIKDIKAMVEQAAIQSIHKSSSNVKQIMVKTGQEHIVEDVYGAYDPLLYERTGQVKD
AFITTNESNGVSLDNIREDDGKDIATVIETGQGYTYPDSYGYGYGNPRPFMKNTSETLRD
GRLTAALKKDLKADGIKTD
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaaacaattaaagatatcaaagctatggttgaacaagctgcaattcaatcaatt
cataagtcttcctctaatgtgaaacaaattatggtaaaaacaggacaagagcatattgtt
gaagatgtttacggtgcatatgatcccctactttatgaacgcacaggacaagttaaagat
gcctttataaccaccaacgaaagcaacggggtgtcattggacaatattagagaagatgat
ggaaaagacattgctacagttattgaaaccgggcaggggtatacataccctgattcatat
ggatatggatacggtaaccctcgtccttttatgaagaatacctctgagaccttaagagat
ggacgattaaccgcagcgctaaaaaaagatttaaaagcagatggtattaaaacagactaa

DBGET integrated database retrieval system