KEGG   Bacillus subtilis subsp. subtilis 168: BSU21300Help
Entry
BSU21300          CDS       T00010                                 

Gene name
yomM
Definition
(RefSeq) recombinase-like protein YomM
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_integrase Phage_int_SAM_4 DUF3826 Phage_int_SAM_1
Motif
Other DBs
NCBI-GeneID: 939145
NCBI-ProteinID: NP_390013
Pasteur: BG13600
BSORF: BG13600
UniProt: O31971
Position
2245147..2246148
Genome map
AA seq 333 aa AA seqDB search
MTKPIEKNMLRSRAIKLPEVTESMWEQVDEEHRNLVQEFLDAHSFRDKTRKQYYSSLRQF
FWWVHTSLNGKKLYKISKRDFIRYQSFLKNRGMSSSGIALKKAGVSSLNNYIENVVAEDD
HNYEKFRNFTRGLPAIPKTTTYEKVKVTYDDYKLMMDALKEDENYLGMAWLATAFNVGGR
RAELIQLKTEILDYPVPEGQSYVMSHKVFGKGKGEGKPLEYMINTEALEYLRLWHEKRGY
DHEYLFTTQYGGEPKQMSESWADYFCSDVLSDILGRRINPHLFKASCITYLLEVKKVKIE
LISKYVAHHEDVSTTIKHYDLRDFEEEKNQIFV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaccaattgaaaagaatatgctcagatctcgagcaataaaactccccgaggtc
acggaatcaatgtgggagcaagtagatgaagagcacagaaacttggttcaagagttttta
gatgctcattcatttagagataaaacacgaaagcagtattactcctcccttcgccaattc
ttttggtgggtacatacctctcttaacgggaaaaaactttataagatctcaaagcgtgat
ttcattaggtatcaaagtttcttaaagaatcgtgggatgtcttcaagtgggattgcttta
aaaaaagccggtgtatcatcgttaaataattatatcgaaaatgttgttgcagaagatgat
cataattatgagaaattcagaaatttcacccgcgggcttccagctattcctaaaaccact
acctatgaaaaagttaaagttacatatgatgattataaactgatgatggacgccctaaaa
gaggacgaaaattatttggggatggcatggcttgctactgcctttaatgttggcgggcga
agagcagaactcatacagttaaaaacagaaatattagattaccctgttccagagggtcag
tcatacgtgatgagtcataaggtatttggaaaaggtaaaggtgaaggaaaacctcttgag
tacatgattaacacagaagcactggagtatcttcgcttatggcatgaaaaacgtggctat
gatcatgaatacctcttcactactcagtatggcggagagcctaaacagatgtcagagtct
tgggctgattatttttgctctgatgtgttatcagacatccttggtcgacgtataaacccc
cacctctttaaagcttcgtgcatcacttatctcctagaagttaagaaagtcaaaattgaa
ttgataagcaaatatgtagctcatcatgaagatgtctcaacaacaatcaaacattatgat
ttacgggattttgaagaagaaaaaaatcaaatatttgtttag

DBGET integrated database retrieval system