KEGG   Bacillus subtilis subsp. subtilis 168: BSU21310Help
Entry
BSU21310          CDS       T00010                                 

Gene name
yozP
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939141
NCBI-ProteinID: NP_390014
Pasteur: BG13763
BSORF: BG13763
Position
complement(2246151..2246480)
Genome map
AA seq 109 aa AA seqDB search
MKVIHGIRVYEKGEKVFFETEMPSIPEYMYSKFGWKIIEIDGKNYWAPMEEEEYIHIVAK
YLGISPSEVDLNLVHCGTMGDNGCFGDCTGNRFCKRWSTGDSTGCICGA
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagtaatccatggaatcagagtatatgaaaaaggagaaaaagtcttttttgaaact
gaaatgccatccattccagaatacatgtattctaaattcgggtggaaaattatcgaaata
gatggtaagaactattgggccccgatggaggaggaagaatatatacatattgttgcaaaa
tatttagggatttcaccgagtgaagttgatttaaacttagttcattgtggaacgatgggg
gacaatggttgttttggagattgtaccggaaatagattttgtaaaaggtggagtactgga
gattcaacaggatgtatttgtggtgcttaa

DBGET integrated database retrieval system