KEGG   Bacillus subtilis subsp. subtilis 168: BSU21320Help
Entry
BSU21320          CDS       T00010                                 

Gene name
yomL
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939143
NCBI-ProteinID: NP_390015
Pasteur: BG13599
BSORF: BG13599
UniProt: O31973
Position
complement(2246656..2247342)
Genome map
AA seq 228 aa AA seqDB search
MRKKRVITCVMAASLTLGSLLPAGYATAKEDSKTTPSYEELALHYKMKSEKISSNGKLVE
IEYVSGNETHKVQMNGNDHTVKVDGIEQKGLNFEYDENAANRTNYENNNLKSNEFTTQAA
KPKKGYHYVGTLSGHTKAAKNALSVTMSLVGIVPGLGWGSKAATILFSYWAKEQIPDAYY
KYDLYEKGAMTDSWYQYATVQFFEDKAHKKKMGKPWTSTPAKVDLPNS
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
ttgagaaagaaaagagttattacttgtgttatggctgcatcattgactttaggctcactt
ttacctgcaggttacgctactgcaaaggaggactctaagacaaccccttcttacgaagaa
ctagctctacattacaaaatgaaaagtgaaaagatttcatcgaacgggaaattagttgaa
attgagtatgtgagtggaaatgaaactcacaaagttcagatgaacggaaatgatcatact
gtaaaagtcgatggcatagaacaaaaaggcttaaactttgagtatgatgaaaatgctgct
aacagaacaaattatgaaaacaataatttgaaatcaaatgaattcacaacacaggctgca
aaacctaaaaagggataccattatgtggggactttatctgggcatacaaaagcagctaaa
aatgcgttatcagttacaatgtcattagtcggtattgtccctggcttgggatgggggagt
aaggctgccactattttattctcttattgggcaaaagaacaaatccctgatgcgtattat
aaatatgatttatacgaaaaaggagcaatgactgatagttggtatcagtatgctacagtt
caattttttgaagataaagcccataaaaagaaaatgggcaaaccgtggactagtactcct
gcaaaagtagatttacctaatagctaa

DBGET integrated database retrieval system