KEGG   Bacillus subtilis subsp. subtilis 168: BSU21329Help
Entry
BSU21329          CDS       T00010                                 

Gene name
youB
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 8303116
NCBI-ProteinID: YP_003097752
UniProt: Q9K3A9
Position
complement(2247367..2247543)
Genome map
AA seq 58 aa AA seqDB search
MNNKKNIFDIVMYIIFGVLSLFLVAKTDYGTGVLVFVAILYLAVIAYKIKQVFSNSDS
NT seq 177 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaagaaaaatatctttgatattgtaatgtacattattttcggtgtgttaagt
ctttttctagttgcaaaaactgattatggcactggagttttagtgtttgttgcaatttta
tacctcgctgtaattgcttataaaattaagcaagtatttagtaattcagattcttaa

DBGET integrated database retrieval system