KEGG   Bacillus subtilis subsp. subtilis 168: BSU21330Help
Entry
BSU21330          CDS       T00010                                 

Gene name
yomK
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939137
NCBI-ProteinID: NP_390016
Pasteur: BG13598
BSORF: BG13598
UniProt: O31974
Position
2247889..2248335
Genome map
AA seq 148 aa AA seqDB search
MFNKKVLKHNLAEMNPKELIKFIKHEFPINGQDYHTHARKVQIIKSLSPSELSSAIARME
GIKSQYDPSKTWGIGSLILGTSFIGFQVLFGVNISKITEGNRLNALIYVLITIIICLWTL
RNIIKDKENATTADYLKELLIQIKSEKN
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttcaataaaaaagtattaaagcacaatctggctgaaatgaatcctaaagaattaata
aagtttatcaagcatgaatttcctattaatggacaagattatcatacacatgcaaggaaa
gtccaaataataaaatctttaagcccgtctgaattatcatctgccattgcaaggatggaa
ggaataaaatcgcaatatgatccatctaaaacttgggggattggaagtttgattttggga
acatcgtttataggatttcaagtattatttggtgtgaatatatcaaaaattactgaggga
aaccgattgaatgcattaatttacgtattaatcacaatcataatttgcttatggacactt
cgtaatattataaaagataaagaaaatgctacaactgcagattatctcaaagaactgctc
attcagataaaatcagaaaagaactaa

DBGET integrated database retrieval system