KEGG   Bacillus subtilis subsp. subtilis 168: BSU21340Help
Entry
BSU21340          CDS       T00010                                 

Gene name
yomJ
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 939133
NCBI-ProteinID: NP_390017
Pasteur: BG13597
BSORF: BG13597
UniProt: O31975
Position
2248417..2249100
Genome map
AA seq 227 aa AA seqDB search
MGYKFMAYGGYFLFCLFFLLMDGWRGMGICLIIVGLALLALEPYKIKAQKNIDKLKENAE
TLKHFDGGFNPDNFFNTYKTKIAFKESDSLVKIYQLNKDEHIEEYTIPFSNVIESEIALD
NQIISKVSKSGIVAGGLLAGGIGAAIGGLSASSIQNEMVKSVTLKITVEDLGKPIHYIDF
LPTQEVEGYNIQGYKKDSNVIQQALTNAEYWHGVMDVIIKKANKVAQ
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgggatataagtttatggcttatggtggctattttttattctgtcttttctttttgcta
atggacggctggagaggcatgggaatttgcttaataattgtaggtttagccctattagca
cttgagccctataaaattaaagcccaaaaaaatatagataaactaaaagaaaatgcggaa
acacttaagcacttcgacggtggttttaatccagacaatttctttaatacttacaaaact
aaaattgcatttaaggaatctgattcccttgtgaaaatatatcagcttaataaagatgaa
catattgaagaatacacaatccctttttccaatgttatagaatccgaaattgctttagac
aatcaaataatttctaaagtatcaaaatcaggaatcgtagctggtggcctgttagctgga
ggaattggagctgcaattggagggttgtctgcctcttcaatacaaaatgaaatggtcaaa
tctgtcacgctaaagattactgttgaagacctcggtaagcctatccattatatcgatttt
ctccccacacaagaagttgaagggtataatattcaggggtataaaaaagatagcaatgtc
attcaacaagcacttacgaatgcagaatattggcatggtgttatggatgtaattattaag
aaagcaaacaaagtcgctcaataa

DBGET integrated database retrieval system