KEGG   Bacillus subtilis subsp. subtilis 168: BSU21350Help
Entry
BSU21350          CDS       T00010                                 

Gene name
yomI
Definition
(RefSeq) transglycosylase YomI
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT PhageMin_Tail Peptidase_M23 PYRIN TcpA
Motif
Other DBs
NCBI-GeneID: 939138
NCBI-ProteinID: NP_390018
Pasteur: BG13596
BSORF: BG13596
UniProt: O31976
Position
2249154..2256011
Genome map
AA seq 2285 aa AA seqDB search
MSQNLKIILTPQADTSSKTVEQLNQQIKSLEKKLNSLKLNTNIDSTTLKALQEFSSAIDT
YQKNLKSYNQTVKETSTVIKNADGSVEKLTQQYKKNGEILQRETKIINNRNTALKQETQE
VNKLTQATEKLGQVQKKTVQRNLQGQPTKVVQKNRHGFDDIVYTTDPKTNSTSSKTTTNY
DQQRRAIEQLKQDLEKLRQQGIVTDTTISSLGRKINTAQSAQQIEALQNRIRMLDDKSAA
VAKNNELKKTIELYQRQAQVNVQNLNTRYGSSMGSSNRQAVQDYLNAVNSLNVSTGSNNI
RSQIQSLNMQFRELASNAQTAANQASSFGAELTQTFKSMSTYLISGSLFYGAISGLKEMV
SQAIEIDTLMTNIRRVMNEPDYKYNELLQESIDLGDTLSNKITDILQMTGDFGRMGFDES
ELSTLTKTAQVLQNVSDLTPDDTVNTLTAAMLNFNIAANDSISIADKLNEVDNNYAVTTL
DLANSIRKAGSTASTFGVELNDLIGYTTAIASTTRESGNIVGNSLKTIFARIGNNQSSIK
ALEQIGISVKTAGGEAKSASDLISEVAGKWDTLSDAQKQNTSIGVAGIYQLSRFNAMMNN
FSIAQNAAKTAANSTGSAWSEQQKYADSLQARVNKLQNNFTEFAIAASDAFISDGLIEFT
QAAGSLLNASTGVIKSVGFLPPLLAAVSTATLLLSKNTRTLASSLILGTRAMGQETLATA
GLEAGMTRAAVASRVLKTALRGLLVSTLVGGAFAALGWALESLISSFAEAKKAKDDFEQS
QQTNVEAITTNKDSTDKLIQQYKELQKVKESRSLTSDEEQEYLQVTQQLAQTFPALVKGY
DSQGNAILKTNKELEKAIENTKEYLALKKQETRDSAKKTFEDASKEIKKSKDELKQYKQI
ADYNDKGRPKWDLIADDDDYKVAADKAKQSMLKAQSDIESGNAKVKDSVLSIANAYSSID
ISNTLKTSISDVVNKLNLKDDLDPEELEKFSSSLGKLQEKMQKALDSGDEKAFDNAKKDL
QSLLETYSKSDSSIDVFKMSFDKAQKNIKDGDKSLSSVKSEVGDLGETLAEAGNEAEDFG
KKLKEALDANSVDDIKAAIKEMSDAMQFDSVQDVLNGDIFNNTKDQVAPLNDLLEKMAEG
KSISANEANTLIQKDKELAQAISIENGVVKINRDEVIKQRKVKLDAYNDMVTYSNKLMKT
EVNNAIKTLNADTLRIDSLKKLRKERKLDMSEAELSDLEVKSINNVADAKKELKKLEEKM
LQPGGYSNSQIEAMQSVKSALESYISASEEATSTQEMNKQALVEAGTSLENWTDQQEKAN
EETKTSMYVVDKYKEALEKVNAEIDKYNKQVNDYPKYSQKYRDAIKKEIKALQQKKKLMQ
EQAKLLKDQIKSGNITQYGIVTSTTSSGGTPSSTGGSYSGKYSSYINSAASKYNVDPALI
AAVIQQESGFNAKARSGVGAMGLMQLMPATAKSLGVNNAYDPYQNVMGGTKYLAQQLEKF
GGNVEKALAAYNAGPGNVIKYGGIPPFKETQNYVKKIMANYSKSLSSATSSIASYYTNNS
AFRVSSKYGQQESGLRSSPHKGTDFAAKAGTAIKSLQSGKVQIAGYSKTAGNWVVIKQDD
GTVAKYMHMLNTPSVKAGQSVKAGQTIGKVGSTGNSTGNHLHLQIEQNGKTIDPEKYMQG
IGTSISDASQAEAERQQGIAQAKSDLLSLQGDISSVNDQIQELQYELVQSKLDEFDKRIG
DFDVRIAKDESMANRYTSDSKEFRKYTSDQKKAVAEQAKIQQQKVNWIQKEIKTNKALNS
AQRAQLQEELKQAKLDLISVQDQVRELQKQLVQSKVDETLKSIEKSSSKTQGKIKDVDNK
ISMTEEDEDKVKYYSKQIKLIQQQQKEAKKYIKQLEEQKKAAKGFPDIQEQITEEIENWK
DKQKDFNLELYNTKKSIKDIYKSLADEVVSIYKEMYEKMRDIELEAHQKATQDLIDEIDK
TDDEAKFQKELKERQDSIQKLTDQINQYSLDDSEFGKSKVKELTEQLQKEQLDLDDFLKD
RESNKRKEALQDQLEKDEESINNKYDNLVNDERAFKKLEDKIMNGKITDIAKQLNEFSKF
INTNMESIGKSISNNLIDKLKEASNALNTAVKGNTTGKKVSSFASGGYTGTGLGAGKLAF
LHDKELILNKTDTANILDTVKAVRETAVDDSPKWGQGVKLADLIKKGITSIPSLVPNVNQ
SMLTNSLIPNLKKIEIPSKTIASSGDKTINLTNTFHIDKLIGGESGARSMFESIKNEVVK
LNGSM
NT seq 6858 nt NT seq  +upstreamnt  +downstreamnt
ttgagtcaaaacctcaaaattatactaaccccgcaagctgatacctcatccaaaactgtc
gaacagttaaatcagcaaattaaatccctggaaaagaaactcaactccctcaagctcaat
acaaacattgattctacaaccttaaaagctctgcaagaattctcctctgctatcgacaca
tatcagaaaaacctaaaatcctataatcaaacagttaaagaaacctcaacagtaattaag
aatgctgacggatcagttgaaaagctcacccagcagtataagaaaaatggtgagatactt
caacgtgaaacaaaaataatcaacaatcgtaatacagcattaaagcaagaaactcaagag
gttaacaagctaacacaggccactgagaaactaggacaggttcaaaaaaagactgtgcag
agaaatctgcaaggacagccaacaaaggtagtgcagaaaaaccgccacgggttcgatgat
attgtttatacaactgatcctaaaactaattcgacctcctcaaaaactacaactaattat
gaccaacaaaggagagcaattgagcagcttaagcaagatttagagaagcttagacagcaa
ggtattgttactgatacgaccatctcatctcttggccgaaaaataaacacagctcaatcc
gctcaacaaattgaagcactgcaaaataggataaggatgttagatgataaatctgcggca
gttgcgaagaacaatgaattaaagaaaaccattgaattatatcagcgacaggcacaagta
aatgttcaaaacctaaatacacggtatggcagttctatgggctctagtaatagacaagct
gttcaagattatttgaatgcagtaaatagtcttaatgtaagcactggaagcaataatatc
agatcacaaattcaaagcttgaatatgcaatttagagaattagcctccaacgctcaaaca
gctgctaatcaagcctcttcttttggagcagaactaacccaaaccttcaaaagcatgtcc
acctatttaatctccggttctttattctacggagctatctctggacttaaagaaatggta
tcccaggcaatagaaattgatactctcatgacaaatattcgccgtgttatgaatgagccg
gattataaatataatgaacttctccaagaatctattgacttaggtgatacactttcaaat
aaaatcacagatattcttcaaatgacaggcgattttgggagaatgggtttcgatgaaagt
gagctctccacgttaacgaaaactgcccaagttcttcaaaatgtctctgatttaactccc
gatgatacagttaacactctaacggcagcaatgctcaactttaatattgcagcaaatgat
tcaatatcaattgcagataaattaaatgaggttgataataactatgctgttacaactcta
gatctggccaattctatccgtaaagctggttcaactgcttctacattcggggtagagcta
aatgatcttattggttatacaactgcaattgctagtacaacacgtgaatcagggaatatc
gtcgggaactccttaaagacaattttcgcgcggattgggaataatcaaagctcaattaaa
gcgttagaacagattggtatctcagttaaaacagctggtggtgaagctaaatcagcaagt
gatttaattagtgaagttgctggtaagtgggatacgctttctgatgctcagaaacaaaat
acttcaattggagtagctggtatttatcaattatcccgttttaatgcaatgatgaacaac
ttctctattgctcagaatgcggctaaaactgcggctaactcaacaggaagtgcttggagt
gagcagcaaaagtatgcagatagtctacaagctagggtaaataagcttcaaaataacttc
actgaatttgctattgcagcttctgatgcttttattagcgacggattaattgaatttact
caagccgcaggttctttgcttaacgcttctacaggagtaatcaaatcagttgggttccta
cctccccttttagctgcagtaagcactgcaacccttttgctcagtaagaatacccgcaca
ttagccagcagcctaattttgggcacacgtgcaatggggcaagaaactttagcgactgct
gggctagaagctggtatgactcgtgcagcagtcgcctcaagagttctaaaaactgctctt
cgagggttgcttgtttcaactttagttggcggtgcatttgctgctttgggatgggcgcta
gaatcattaatttcttcttttgcagaagctaaaaaagctaaagatgattttgagcagagc
cagcaaaccaatgtcgaagcaattacgaccaataaagactccactgataaactaatacag
caatataaagagcttcaaaaagttaaagagtcaagatctttaacttcagatgaagagcaa
gaataccttcaagtcactcagcaattagcacaaactttccctgcattagttaaaggctat
gattctcaaggaaatgcaattcttaagacaaataaagagcttgaaaaagcgattgagaat
actaaagagtatttggctttaaagaaacaagaaacaagagacagcgcaaagaaaacattc
gaagacgcttctaaggaaattaaaaagtctaaggatgaattaaagcagtacaaacaaata
gctgactacaacgataaaggtagacctaaatgggatctcattgcagatgacgatgactat
aaggttgcagctgataaagctaaacaaagtatgctcaaagctcaatctgacattgagagt
ggaaatgctaaagttaaagatagcgtcctttcaattgcaaatgcttatagttcaattgat
atcagtaatactttaaagacgagtattagtgatgttgtcaacaaacttaacttaaaagat
gatttagatcctgaagaattagaaaaattctcctcttctttaggaaagcttcaagaaaaa
atgcaaaaagctttagattcaggcgatgaaaaagctttcgataacgcaaaaaaagatctt
caaagtctcttggaaacatactccaaatccgattcttctattgatgtttttaaaatgagc
ttcgacaaagcacagaagaacataaaagatggagataagagcttatcttccgtcaaatct
gaagttggtgatttaggtgagacgctggcagaagcaggtaacgaggcagaagattttggt
aagaagctaaaagaagctctggatgcaaatagtgttgatgatattaaggcagctattaaa
gaaatgtcagatgctatgcagttcgattccgttcaagatgtcttaaatggggatattttt
aataacaccaaagatcaagtagctcctctcaatgatcttctggaaaaaatggctgaaggt
aaaagtatttctgcaaatgaagctaatacccttattcaaaaagataaggaacttgcccag
gctattagcatcgaaaatggcgttgtgaaaattaaccgtgatgaagttatcaaacaaaga
aaagttaaacttgatgcttataacgacatggttacctacagcaataaattgatgaaaaca
gaagttaacaacgctatcaaaactttaaacgctgataccttacggattgacagcctgaaa
aagctacgaaaagaacgaaagcttgatatgtctgaggccgaactgtcagacctagaagtt
aagtcaattaataatgttgcagatgcaaaaaaagaacttaaaaagcttgaagagaaaatg
cttcaacctggtggatactccaatagtcaaattgaagcaatgcaaagcgttaaatcagct
ttagaatcttatatttctgcatctgaagaagccaccagtacacaagaaatgaataaacag
gcacttgttgaagctggaacatcattggagaattggacagatcaacaagaaaaagccaat
gaagaaaccaagacttccatgtatgttgttgataaatacaaggaagcattagaaaaagtt
aatgctgagattgacaagtacaacaagcaggtcaatgattatcctaaatactctcagaaa
tatcgagatgcaatcaagaaagaaattaaagcacttcagcaaaagaaaaagcttatgcag
gaacaagctaagctgcttaaagatcaaattaaatccggtaacattactcaatacggtatt
gtaacctctacaacttcttctggtggaaccccctcctcaactggtggatcatattcaggc
aagtattcaagctacataaattcagcagctagtaaatacaatgttgaccctgcccttatt
gcagctgtaattcagcaagaatcagggtttaatgctaaagcacgatctggtgtaggtgcc
atgggattaatgcaactgatgccagcaacagcaaaaagcttaggagtaaataacgcttac
gatccttatcaaaatgttatgggtggaacaaagtacctcgcccaacaacttgaaaagttt
ggcggtaatgttgaaaaagcattggctgcatataatgctgggcctggtaacgtaattaaa
tatggtggtatccctccttttaaagaaacacagaattacgtcaagaagatcatggccaac
tatagcaaatcgctctcatctgccacttcttcaatcgccagctattatacaaataatagc
gcttttagggtaagctccaaatatggacaacaggaatctggtctccgctcctccccacac
aaaggaactgattttgctgcaaaagcaggtacagcaattaaatctcttcaaagtggtaaa
gtccaaattgctggctacagtaaaactgcaggtaactgggttgttattaaacaggatgat
ggaacagttgccaagtacatgcacatgcttaacactccttctgtaaaagcaggtcaatca
gttaaagccggtcaaactattggtaaagttggtagtacagggaactcgactgggaaccac
cttcatttacagatcgaacaaaatggaaaaacaatcgatcctgaaaagtacatgcaaggt
attggaacttctatttcagatgcgtcacaagctgaggcagaacgacaacaagggatagct
caggctaaatctgatcttctctccctccaaggagatatcagttcagtcaatgatcagatt
caagaacttcagtatgaactagttcaatctaaactcgatgagtttgataaaagaattgga
gattttgatgttcggatagcaaaagatgagtcaatggctaacagatacacttctgacagc
aaggaattccgaaaatacacctctgatcagaaaaaagctgtggcagagcaagctaaaatc
caacaacaaaaagttaattggattcaaaaagaaattaaaacaaataaagcattgaactcc
gctcaacgtgcacagcttcaagaagagcttaaacaggccaagctagatttaatttctgtt
caagaccaggttcgtgagctacagaaacaacttgttcaatctaaagttgatgagacactt
aagtcaattgaaaagtcatcttctaaaacccaagggaaaattaaagatgtcgataacaaa
atttcaatgactgaagaagatgaagacaaggttaaatactatagcaagcaaataaagctc
attcaacaacaacaaaaggaagcgaagaaatacattaagcagcttgaagaacaaaagaaa
gctgcgaaaggtttccctgacatccaggaacagatcactgaagaaatcgaaaactggaaa
gataaacagaaagattttaaccttgagctttataacaccaagaagtcgatcaaggatatc
tataaatcattggctgatgaagttgtatccatctacaaagagatgtacgaaaaaatgcgt
gatattgagttagaagcgcatcagaaagcgactcaagacttgatcgatgagatagacaag
actgatgacgaggctaaatttcaaaaagaattaaaagaaagacaagacagtattcaaaag
ttgactgaccaaattaatcaatactctcttgatgattctgaattcggaaagtcaaaagtc
aaagaactaactgaacagcttcaaaaagagcagttagaccttgatgattttctaaaggat
cgcgaaagtaacaaacggaaagaagcgctccaagatcagctcgaaaaagatgaggagtca
atcaacaataaatacgataatcttgtaaatgatgaacgagcctttaaaaagcttgaggat
aagattatgaatggaaaaatcaccgatatcgctaagcagcttaatgagttttctaagttt
attaataccaatatggagtccattggaaaaagtatttcaaacaacctgattgataaactc
aaagaagcatctaatgcactgaatactgctgtcaaaggcaacacgacaggtaaaaaagta
tcctctttcgcttctggagggtacactggaacaggattaggtgctggtaaacttgcattc
ctacatgacaaagaactgatcttaaataaaactgacacagccaacatccttgatacggta
aaagctgttcgtgaaaccgctgtggacgattccccaaaatggggccaaggagtaaaatta
gcagaccttattaaaaaaggaattacttctattccttcattagttcctaacgttaatcaa
tcaatgttaacaaacagtttaattccaaatttaaagaagattgagatcccctcaaaaaca
attgcttcttctggagataaaacaattaatttaacgaatactttccacattgataagcta
ataggaggagaatcgggagcgagatcgatgtttgaaagcattaaaaacgaagttgtaaaa
ctaaatggtagcatgtaa

DBGET integrated database retrieval system