KEGG   Bacillus subtilis subsp. subtilis 168: BSU21360Help
Entry
BSU21360          CDS       T00010                                 

Gene name
yomH
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sipho_tail
Motif
Other DBs
NCBI-GeneID: 939139
NCBI-ProteinID: NP_390019
Pasteur: BG13595
BSORF: BG13595
UniProt: O31977
Position
2256062..2256820
Genome map
AA seq 252 aa AA seqDB search
MIRESQYFMFNNIPSYELGAVNVNTEGGLLEESFIANRTVNETYTRLSSEPYVDNVKLEP
YEIPLNFYIENHLDEKNVRRVARWLNVDDYKPLSFSRNLDIIYFALPINATDLVHNCSND
GYVKLTMKVFPYKYGQETTTHWFDVTSGVKNIEIENIGDVDIPLSLEFKKIGDGDITVEN
LTLYRTPLKFTGIKHHEVINVDSNKKLITSSISGYECYDQVNEEYVILTRGKNRIKINGE
CYIRLKYRYKYL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgattagagaaagtcaatactttatgttcaataatatcccttcttatgaattaggagcc
gtaaatgtaaatacagaaggaggacttttagaggagtcgtttattgcaaatagaacagta
aatgaaacatacactaggctatcttcagaaccatatgtagacaatgtcaaacttgagcca
tatgagatcccattgaatttttacatagaaaatcatctagatgaaaaaaatgttcgaaga
gttgctcgttggttaaatgtagatgattataaacctctctcctttagtagaaatttagac
ataatttattttgccttgccaataaacgctacagatttagttcataactgttctaacgat
ggatatgtgaagctcacaatgaaggtattcccctataaatatggacaagaaacaacaact
cattggtttgatgtcacatcaggtgttaagaatattgaaattgaaaacataggagatgtg
gacattccgttatctcttgaatttaagaagataggcgacggtgacataactgttgagaac
ttaactttatatagaacacctctgaagtttacgggaataaaacatcatgaagttatcaat
gttgattccaataaaaaattgatcacttcaagtatttcgggttatgaatgttatgaccaa
gtaaatgaagagtatgtgattttaacaagaggtaaaaacagaattaaaataaatggtgag
tgctatattcgattaaaataccgatacaaatatttatag

DBGET integrated database retrieval system